Protein Info for SO1925 in Shewanella oneidensis MR-1

Annotation: HlyD family secretion protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 354 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 38 to 343 (306 residues), 231.5 bits, see alignment E=6e-73 PF25973: BSH_CzcB" amino acids 63 to 189 (127 residues), 40.6 bits, see alignment E=5.7e-14 PF25917: BSH_RND" amino acids 63 to 181 (119 residues), 43.6 bits, see alignment E=6.7e-15 PF25954: Beta-barrel_RND_2" amino acids 198 to 268 (71 residues), 47.8 bits, see alignment E=4e-16 PF25967: RND-MFP_C" amino acids 274 to 333 (60 residues), 32.8 bits, see alignment E=1.6e-11 PF25989: YknX_C" amino acids 275 to 342 (68 residues), 51.3 bits, see alignment E=2.5e-17 PF25975: CzcB_C" amino acids 276 to 331 (56 residues), 35.6 bits, see alignment E=2.2e-12

Best Hits

KEGG orthology group: None (inferred from 100% identity to son:SO_1925)

Predicted SEED Role

"Probable Co/Zn/Cd efflux system membrane fusion protein" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EFP5 at UniProt or InterPro

Protein Sequence (354 amino acids)

>SO1925 HlyD family secretion protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MEKSKIVKFALPVLLVSMLAACGEEEVAKKEEKYAIPVETTTVIQGNVSSFYSTTATLEA
PQEANVVSRIAGLIEVINVEEGDRVKKGQSLAIIDAKRQQYDLDRSEAEVKIIEQELNRL
KKMNNKEFISADSMAKLEYNLQAAIARRDLAELQVKESHVVSPIDGIIAKRYVKAGNMAK
EFGDLFYIVNQDELHGIVHLPEQQLTSLRLGQEAQVFSNQQSKNAINAKVLRISPVVDPQ
SGTFKVTLAVPNQDARLKAGMFTRVELKYDTHENVITVPYSALINQDNKQALYVIAGTNA
NRREVEIGYREGDAVEIVSGIKPGEVVVTRGQQNLKDQSLVEVITPLDLASAKN