Protein Info for SO1918 in Shewanella oneidensis MR-1

Annotation: MATE efflux family protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 501 transmembrane" amino acids 15 to 40 (26 residues), see Phobius details amino acids 52 to 77 (26 residues), see Phobius details amino acids 92 to 115 (24 residues), see Phobius details amino acids 135 to 156 (22 residues), see Phobius details amino acids 168 to 188 (21 residues), see Phobius details amino acids 194 to 214 (21 residues), see Phobius details amino acids 235 to 256 (22 residues), see Phobius details amino acids 272 to 296 (25 residues), see Phobius details amino acids 316 to 336 (21 residues), see Phobius details amino acids 349 to 371 (23 residues), see Phobius details amino acids 383 to 403 (21 residues), see Phobius details amino acids 409 to 432 (24 residues), see Phobius details PF01554: MatE" amino acids 28 to 182 (155 residues), 102.6 bits, see alignment E=1.9e-33 amino acids 241 to 401 (161 residues), 77.6 bits, see alignment E=9.1e-26 TIGR00797: MATE efflux family protein" amino acids 29 to 404 (376 residues), 200.9 bits, see alignment E=1.5e-63

Best Hits

KEGG orthology group: None (inferred from 100% identity to son:SO_1918)

Predicted SEED Role

"Multidrug and toxin extrusion (MATE) family efflux pump YdhE/NorM, homolog"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EFQ1 at UniProt or InterPro

Protein Sequence (501 amino acids)

>SO1918 MATE efflux family protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MTQAKFVEGSILRHILVMSSTAAVGISALFVVDLLDIFFLSLLGEHELAAAVGYAGSISF
FTTLIGIGLSIALGALVSRSIGAKDVELAKRLLLNSAVVTTLISVFVSIVVTTFIPELVT
LVGASGHTAELAESYLYILVPSLPFICLAMALGGALRSVGDAKLSMMSTLAGGGVNAVLD
PIFIFLFAMGIEGAALASVLARITVFVIAGRGVMVKHQLLGKFNRSDFKADLKPIFAIAG
PAILTNIATPIGNAFVTRAIADFGDAYVAGWAVLGRLVPVTFGMIFALSGAIGPIVGQNF
GAGRFDRVRESLTKAIQFCTLYVVVMSLLLFLLKSQIVSLFDMKGDSAALIEFFCSYIAV
FFIFSGILFVANASFNNLGKAKYSTLFNVGKATLGTVPFVYVGAQLGGVYGVLIGQVIGS
ILFGVVGVWVAYRLVDKVVLTSTGHGVVSLATDADELMTDTVAPSATSPLSSSCAQMAQL
TEEQEMEPVLPLIGQQDNSRR