Protein Info for SO1917 in Shewanella oneidensis MR-1

Annotation: multidrug resistance protein, putative (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 413 transmembrane" amino acids 15 to 33 (19 residues), see Phobius details amino acids 52 to 72 (21 residues), see Phobius details amino acids 80 to 99 (20 residues), see Phobius details amino acids 105 to 127 (23 residues), see Phobius details amino acids 139 to 159 (21 residues), see Phobius details amino acids 170 to 189 (20 residues), see Phobius details amino acids 232 to 253 (22 residues), see Phobius details amino acids 265 to 284 (20 residues), see Phobius details amino acids 296 to 314 (19 residues), see Phobius details amino acids 321 to 342 (22 residues), see Phobius details amino acids 354 to 374 (21 residues), see Phobius details amino acids 381 to 399 (19 residues), see Phobius details PF07690: MFS_1" amino acids 19 to 250 (232 residues), 98 bits, see alignment E=2.8e-32 amino acids 237 to 398 (162 residues), 45 bits, see alignment E=3.6e-16

Best Hits

KEGG orthology group: None (inferred from 100% identity to son:SO_1917)

Predicted SEED Role

"Major facilitator superfamily precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EFQ2 at UniProt or InterPro

Protein Sequence (413 amino acids)

>SO1917 multidrug resistance protein, putative (NCBI ptt file) (Shewanella oneidensis MR-1)
MLDTIIDNKQRDTRLMWALCVASVVVYINLYLMQGMLPLLAEHFSVPGSQATLILSVTSF
SLAFSLLIYAVVSDRIGRHTPIVVSLWLLALSNLLLIWVEDFNALVYVRFLQGILLAAVP
AIAMAYFKEQLSPSTMLKAAGIYIMANSIGGIAGRLLGGVMSQFLSWQESMWLLFLVTLA
GVALTNYLLPSGADAKVMSGGQTSSPSRSKRARLLQDFYGFSHHLTDPQMRLAYAIGGIT
FMMMVNQFSFIQLHLMAAPYEWSRFQATLIFLCYSSGTVASYFTAKWLAKFGQHKLYQWS
WCLMLLGSLLTLFDTTLTICMGFLMTACGFFLTHSCCNSFVAMRASRDRAKATSLYLCCY
YLGAALGGPYLMLFWHKAEWQGVVMGSLTLLALIALSITRLRYHQTKMSPIAV