Protein Info for SO1892 in Shewanella oneidensis MR-1

Name: atoD
Annotation: acetate CoA-transferase, subunit A (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 234 TIGR02429: 3-oxoacid CoA-transferase, A subunit" amino acids 4 to 218 (215 residues), 260 bits, see alignment E=7.4e-82 PF01144: CoA_trans" amino acids 10 to 218 (209 residues), 251.1 bits, see alignment E=3.9e-79

Best Hits

Swiss-Prot: 61% identical to SCOA_HELPJ: Succinyl-CoA:3-ketoacid coenzyme A transferase subunit A (scoA) from Helicobacter pylori (strain J99 / ATCC 700824)

KEGG orthology group: K01028, 3-oxoacid CoA-transferase subunit A [EC: 2.8.3.5] (inferred from 99% identity to spc:Sputcn32_1714)

MetaCyc: 60% identical to succinyl-CoA-transferase subunit A (Helicobacter pylori 26695)
3-oxoacid CoA-transferase. [EC: 2.8.3.5]

Predicted SEED Role

"Succinyl-CoA:3-ketoacid-coenzyme A transferase subunit A (EC 2.8.3.5)" in subsystem Catechol branch of beta-ketoadipate pathway or Leucine Degradation and HMG-CoA Metabolism or Protocatechuate branch of beta-ketoadipate pathway or Serine-glyoxylate cycle (EC 2.8.3.5)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.8.3.5

Use Curated BLAST to search for 2.8.3.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EFS4 at UniProt or InterPro

Protein Sequence (234 amino acids)

>SO1892 acetate CoA-transferase, subunit A (NCBI ptt file) (Shewanella oneidensis MR-1)
MAGLNKVVSSYEEALTGLSDDMTIMVGGFGLCGIPEGLINQMVKMGVKGLTAISNNAGVD
DFGLGLLLKHRQISTMIASYVGENATFEQQMLSGELNVILTPQGTLAEKIRAGGAGIPAF
FTATGYGTPVAEGKETREIKGRHYVLEESLTADFALVRAWKADTMGNLVFRKTAANFNPM
MATAGKITVVEAEFIVEPGELDPDHIHTPGIYVDRVIQGKFEKRIEQRTVKAAK