Protein Info for SO1880 in Shewanella oneidensis MR-1

Name: nlpB
Annotation: lipoprotein-34 NlpB (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 365 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF06804: Lipoprotein_18" amino acids 31 to 358 (328 residues), 395.7 bits, see alignment E=6.8e-123

Best Hits

Swiss-Prot: 100% identical to BAMC_SHEON: Outer membrane protein assembly factor BamC (bamC) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K07287, lipoprotein-34 (inferred from 100% identity to son:SO_1880)

Predicted SEED Role

"Outer membrane protein NlpB, lipoprotein component of the protein assembly complex (forms a complex with YaeT, YfiO, and YfgL); Lipoprotein-34 precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EFT6 at UniProt or InterPro

Protein Sequence (365 amino acids)

>SO1880 lipoprotein-34 NlpB (NCBI ptt file) (Shewanella oneidensis MR-1)
MLKKVTPLFLVAAVAACSSPLERRQANGGEDYVQAEQAPMLKIPEGLKTPPYNKEYDVPA
LGPKANPALVGKNLDIRPPLQVLPMAEGTHVEEGSDNIKIVVESIDNNVDLKQEIFTNLD
DFFAKQAIPIRSRDFDKGSIETDWIESREVLESSLWGSDKEYLLRQRYRFDVETRPHGRT
ANIVIHLVEHEEFYDGKEQKVMLSGEDKQRYTIDMLNSAIAYMSVKREQTIQANRLKQTL
GINVDLITPEEGAAYWSAKAAYKQVWDRLRIVLPEMGFEISDMDSAKGLYFIKFTDNSGF
WSSLWNNNQLSLKEGSYRLLLEDGDTPDETKIWLRDAEDQPLSNDVVSKVYESLSSLMKE
ERKLR