Protein Info for SO1873 in Shewanella oneidensis MR-1

Annotation: hypothetical short chain dehydrogenase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 201 signal peptide" amino acids 1 to 17 (17 residues), see Phobius details PF13561: adh_short_C2" amino acids 35 to 158 (124 residues), 51.1 bits, see alignment E=2.2e-17 PF08659: KR" amino acids 39 to 151 (113 residues), 27 bits, see alignment E=6e-10 PF00106: adh_short" amino acids 39 to 158 (120 residues), 38 bits, see alignment E=1.9e-13

Best Hits

KEGG orthology group: None (inferred from 100% identity to son:SO_1873)

Predicted SEED Role

"short chain dehydrogenase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EFU2 at UniProt or InterPro

Protein Sequence (201 amino acids)

>SO1873 hypothetical short chain dehydrogenase (NCBI ptt file) (Shewanella oneidensis MR-1)
MKTVILIGALGKMGQAALTGLSKHKVITAGRSGNVDHLVDITNENSIRALYEKVGHFDAV
VNTVGFCEYATFAEMTEAQWMTTVMSKMMGQINLVRIGQEYIADKGSFTLISGILNVKPI
PCAIADATTSGAIDTFVKCVAYEMQRGTRINVVNPTVLTEAWDVYGDMMPGFEPVPSTLV
GKAFERSVDGFINGEVLFVDA