Protein Info for SO1840 in Shewanella oneidensis MR-1

Annotation: conserved hypothetical protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 357 transmembrane" amino acids 43 to 64 (22 residues), see Phobius details amino acids 75 to 94 (20 residues), see Phobius details amino acids 109 to 133 (25 residues), see Phobius details amino acids 145 to 173 (29 residues), see Phobius details amino acids 194 to 216 (23 residues), see Phobius details amino acids 226 to 247 (22 residues), see Phobius details amino acids 254 to 274 (21 residues), see Phobius details amino acids 281 to 304 (24 residues), see Phobius details amino acids 310 to 331 (22 residues), see Phobius details PF09925: DUF2157" amino acids 10 to 166 (157 residues), 122.4 bits, see alignment E=6.2e-40

Best Hits

KEGG orthology group: None (inferred from 100% identity to son:SO_1840)

Predicted SEED Role

"putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EFX5 at UniProt or InterPro

Protein Sequence (357 amino acids)

>SO1840 conserved hypothetical protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MRNLTSQVYEWLDQGHITRAQVDELYRHVCTPPSAASWRSLIAQLLQWAGALSLATGIIF
FFAYNWQSLNRISKFALIEVALLLSLVCFVWLYYRGSSQQQSSASHSMFGATLANVALLV
ASILIGGLLALVGQTYQTGADPWQLFALWALAIIPLAWVAGFDGLWLLLLGLVNLSLGLF
ADTSSYLLDERDQIWLFIFVVLNLTFYYAFVFLGSLPSKRWHAPLMQYVSSLAAMGCFTL
LICWMIFDTVDNKKFIFGIWAVYLIHLIFGFWWFRYRLLQVYPLALGGFSLIAVGAALLT
ELLYKDSDPIGGFLLIGLYIILASTGLSSMLRRLHRQFKSEVAASEMSAINEQGAAS