Protein Info for SO1834 in Shewanella oneidensis MR-1

Annotation: acetyltransferase, GNAT family (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 178 PF13302: Acetyltransf_3" amino acids 8 to 148 (141 residues), 110.8 bits, see alignment E=1.3e-35 PF13420: Acetyltransf_4" amino acids 11 to 166 (156 residues), 38.7 bits, see alignment E=1.6e-13 PF00583: Acetyltransf_1" amino acids 61 to 147 (87 residues), 33.4 bits, see alignment E=7.1e-12

Best Hits

KEGG orthology group: None (inferred from 100% identity to son:SO_1834)

Predicted SEED Role

"Ribosomal-protein-S5p-alanine acetyltransferase" in subsystem Ribosomal protein S5p acylation or Ribosome biogenesis bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EFY1 at UniProt or InterPro

Protein Sequence (178 amino acids)

>SO1834 acetyltransferase, GNAT family (NCBI ptt file) (Shewanella oneidensis MR-1)
MLELYTDRLRIRSLQDHDWENFLALHLDPDINRYVRIPEPVEVIHQKFEQRAKTWSYASG
DWLTLVIESLETNEFIGLTGFHCQHLEEQRAEVGYLLARTSHGKGYATESLQAVIDWACL
SLKVHKFVGYCAKDNIASARVMEKCGFQLEGVFRQQFKIGDLWLDECAYGLLAGERQR