Protein Info for SO1826 in Shewanella oneidensis MR-1

Name: exbB2
Annotation: TonB system transport protein ExbB2 (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 160 transmembrane" amino acids 6 to 28 (23 residues), see Phobius details amino acids 79 to 100 (22 residues), see Phobius details amino acids 115 to 139 (25 residues), see Phobius details PF01618: MotA_ExbB" amino acids 47 to 152 (106 residues), 77 bits, see alignment E=5.7e-26

Best Hits

KEGG orthology group: K03561, biopolymer transport protein ExbB (inferred from 100% identity to son:SO_1826)

Predicted SEED Role

"Ferric siderophore transport system, biopolymer transport protein ExbB" in subsystem Campylobacter Iron Metabolism or Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EFY8 at UniProt or InterPro

Protein Sequence (160 amino acids)

>SO1826 TonB system transport protein ExbB2 (NCBI ptt file) (Shewanella oneidensis MR-1)
MAAGGNVLWLVAFVLFVMWALMIERYWYLKWISPKKHRAIIAAWDAREETTSWYAHRIRE
AWVSQASQELNDRMLMIKTLVAICPMIGLLGTVTGMISVFDVMAVQGTSNARLMAAGISM
ATMPTMAGMVAALSGVFVSTRLDQQMKIRLEKLKDRMPHH