Protein Info for SO1825 in Shewanella oneidensis MR-1

Annotation: MotA/TolQ/ExbB proton channel family protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 451 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 274 to 299 (26 residues), see Phobius details amino acids 360 to 382 (23 residues), see Phobius details amino acids 398 to 421 (24 residues), see Phobius details PF01618: MotA_ExbB" amino acids 318 to 435 (118 residues), 101 bits, see alignment E=2.1e-33

Best Hits

KEGG orthology group: K03561, biopolymer transport protein ExbB (inferred from 100% identity to son:SO_1825)

Predicted SEED Role

"MotA/TolQ/ExbB proton channel family protein" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EFY9 at UniProt or InterPro

Protein Sequence (451 amino acids)

>SO1825 MotA/TolQ/ExbB proton channel family protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MKKLITTAVLAASFSLTAGMVSAADAPKTIDQLLQQVKVDRAAEGKVNSKREQEFQAERG
DKAALLKREKDALAAEKQRGKDLNQAFLDNERKIAQLEEDLKTAQGDLGEMFGVVKGEAG
DFAGKLASSNVSAQYPNRDKFIADLGARKQLPKIEELEKFWQEQLFEMAESGKVVKFQGS
VTAIDGSVKTTTIHRVGAYNLTAEGKYVVFNPELNLVQELSIQPEGYQVSSVKKWEQITS
GTAPFYIDPARGVLLNIYTNKASFEDRLESGGTIGYIILVLLALGLLIAAERFIVLAVIG
AKVKNQAKNVDKPGNNALGRILKVYHENKDVDVETLELKLDEAILKETPALEARIPILKV
IAAIGPMLGLLGTVTGMIATFQSIQLFGTGDPKLMAGGISMALVTTVQGLVAALPLMLLH
AMLVARSKSITQILEEQSAGIIAAHAEKRAD