Protein Info for SO1818 in Shewanella oneidensis MR-1

Annotation: conserved hypothetical protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 257 transmembrane" amino acids 12 to 39 (28 residues), see Phobius details amino acids 77 to 99 (23 residues), see Phobius details amino acids 107 to 126 (20 residues), see Phobius details amino acids 147 to 168 (22 residues), see Phobius details amino acids 182 to 203 (22 residues), see Phobius details amino acids 209 to 228 (20 residues), see Phobius details amino acids 236 to 256 (21 residues), see Phobius details PF01925: TauE" amino acids 13 to 251 (239 residues), 170.1 bits, see alignment E=3.2e-54

Best Hits

KEGG orthology group: K07090, (no description) (inferred from 100% identity to son:SO_1818)

Predicted SEED Role

"FIG011065: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EFZ6 at UniProt or InterPro

Protein Sequence (257 amino acids)

>SO1818 conserved hypothetical protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MELLLEPSNWALLAAIGLVAGFIDAVVGGGGLLSIPALLTLGIPPHTALGTNKFAASFGS
SMAAWTFYRQHLLKPAFWYMAFVATFIGAVLGSILVYLLNAQWLEKALPLLIIGIAIYSL
LSPNAISDTDCQAPTQTQPKLKQSLQGLILGAYDGFAGPGIGAFWTVSSGTLYKLPLLHS
CALARAMTFTSNLTALAIFGYLGQVHWQIGLWMGLSMMLGSFVGARCAIKFGMPFIRPLF
ILIVLSIAANLAWSAWF