Protein Info for SO1809 in Shewanella oneidensis MR-1

Name: pspC
Annotation: phage shock protein C (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 128 transmembrane" amino acids 38 to 63 (26 residues), see Phobius details PF04024: PspC" amino acids 7 to 64 (58 residues), 66.6 bits, see alignment E=6.9e-23 TIGR02978: phage shock protein C" amino acids 7 to 128 (122 residues), 159.4 bits, see alignment E=1.7e-51

Best Hits

KEGG orthology group: K03973, phage shock protein C (inferred from 97% identity to shn:Shewana3_2646)

Predicted SEED Role

"Phage shock protein C"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EG05 at UniProt or InterPro

Protein Sequence (128 amino acids)

>SO1809 phage shock protein C (NCBI ptt file) (Shewanella oneidensis MR-1)
MRGTSGRTLYRIPQSGKIAGVCAGIAEYFAIETWLVRVLAVSIFLLGGSGVVFIIYVALW
VILDIKPQNSSVRDDIEVKKKPWQSGEPAKQALSDVNRQFRSLEVRLQNLERHVTSDNFD
LKRQINSL