Protein Info for SO1793 in Shewanella oneidensis MR-1

Name: tig
Annotation: trigger factor (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 434 PF05697: Trigger_N" amino acids 1 to 143 (143 residues), 145.4 bits, see alignment E=2.3e-46 TIGR00115: trigger factor" amino acids 11 to 411 (401 residues), 454.1 bits, see alignment E=2.1e-140 PF00254: FKBP_C" amino acids 155 to 236 (82 residues), 65.9 bits, see alignment E=5e-22 PF05698: Trigger_C" amino acids 262 to 411 (150 residues), 128.3 bits, see alignment E=4.6e-41

Best Hits

Swiss-Prot: 100% identical to TIG_SHEON: Trigger factor (tig) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K03545, trigger factor (inferred from 100% identity to son:SO_1793)

MetaCyc: 63% identical to trigger factor (Escherichia coli K-12 substr. MG1655)
Peptidylprolyl isomerase. [EC: 5.2.1.8]

Predicted SEED Role

"Cell division trigger factor (EC 5.2.1.8)" in subsystem Bacterial Cell Division (EC 5.2.1.8)

Isozymes

Compare fitness of predicted isozymes for: 5.2.1.8

Use Curated BLAST to search for 5.2.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EG20 at UniProt or InterPro

Protein Sequence (434 amino acids)

>SO1793 trigger factor (NCBI ptt file) (Shewanella oneidensis MR-1)
MQVSVEATQGLERRLTISVPAEQIEKLVKDSLQREAKRARIPGFRPGKVPVTVINKRYGA
AIRQDITGEVMQRNFIEAIIAEKLNPAGAPTFVPGATDGEKFEFVATFEIYPEVELKGLD
AIVVEQPKASVTDADVDSMIETLRKQHATFAAVEREAVDGDKVKMNFVGSVDGVEFEGGK
AEDFELQLGSGRMIPGFEAGILGHKAGEEFVIDVTFPEEYHAENLKGKAAKFAITLTEVL
AANLPEVNDEFAALFGITEGGLEALKTEIRKNMNRELEQALKANVKEQVIAGLLANNDIE
LPKALIDGEVNVLRQQAMQRFGGQTANMPELPAELFTEQAARRVKIGLLLGEVIKTNELK
AEDERVQGLIASMASAYEDPSEVIAYYNSNKELMQNMRNVALEEQAVEALLKTAKVTEKT
VAFEEFMNKATGRA