Protein Info for SO1791 in Shewanella oneidensis MR-1

Name: cysS
Annotation: cysteinyl-tRNA synthetase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 459 TIGR00435: cysteine--tRNA ligase" amino acids 2 to 458 (457 residues), 631.2 bits, see alignment E=6.5e-194 PF01406: tRNA-synt_1e" amino acids 15 to 313 (299 residues), 481.5 bits, see alignment E=3.3e-148 PF09334: tRNA-synt_1g" amino acids 36 to 135 (100 residues), 24 bits, see alignment E=4.7e-09 amino acids 246 to 311 (66 residues), 26.6 bits, see alignment E=7.6e-10 PF00133: tRNA-synt_1" amino acids 222 to 304 (83 residues), 26.5 bits, see alignment E=8.5e-10 PF09190: DALR_2" amino acids 341 to 394 (54 residues), 78.2 bits, see alignment 1.7e-25 PF23493: CysS_C" amino acids 409 to 457 (49 residues), 40.2 bits, see alignment 8.9e-14

Best Hits

Swiss-Prot: 100% identical to SYC_SHEON: Cysteine--tRNA ligase (cysS) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K01883, cysteinyl-tRNA synthetase [EC: 6.1.1.16] (inferred from 100% identity to son:SO_1791)

MetaCyc: 73% identical to cysteine--tRNA ligase (Escherichia coli K-12 substr. MG1655)
Cysteine--tRNA ligase. [EC: 6.1.1.16]

Predicted SEED Role

"Cysteinyl-tRNA synthetase (EC 6.1.1.16)" in subsystem Conserved gene cluster possibly involved in RNA metabolism (EC 6.1.1.16)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.1.1.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EG22 at UniProt or InterPro

Protein Sequence (459 amino acids)

>SO1791 cysteinyl-tRNA synthetase (NCBI ptt file) (Shewanella oneidensis MR-1)
MLKIYNSITRQKQEFKPINPGKVGMYVCGVTVYDLCHIGHGRTFVSFDMIVRYLRYAGYE
VNFQRNITDIDDKIIKRANENQEDCNTLTDRLIGEMHKDFDALNMKRPDFEPRATLHIAE
IIDMVERLLARGHAYVAADGDVLFSVASFPEYGRLSGQNLEQLQAGARVEVDDNKQNPMD
FVLWKMSKPGEPTWESPWGPGRPGWHIECSAMNSKHLGLHFDIHGGGSDLQFPHHENEIA
QSCCAHDTPYVNYWMHTGMVMIDREKMSKSLGNFFTIRDVLSHYDAETVRYFLLSGHYRS
QINYSEENLKQARAALERLYTAIKDVDLTVAAAPAEEFVAKFKAAMDDDFNTPEAYSVLF
DMVREINRLKLTDMAEASALAVSMKQLADVLGLLHQSPDAFFKGEGSDDEVAEIEALIVE
RNRARTEKDWPAADVARNRLNELGVVLEDGPSGTTWRKK