Protein Info for SO1782 in Shewanella oneidensis MR-1

Name: mtrD
Annotation: decaheme cytochrome c MtrD (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 306 signal peptide" amino acids 1 to 16 (16 residues), see Phobius details PF13435: Cytochrome_C554" amino acids 35 to 85 (51 residues), 17.5 bits, see alignment 2.4e-06 TIGR03508: decaheme c-type cytochrome, DmsE family" amino acids 43 to 300 (258 residues), 324 bits, see alignment E=6.9e-101 PF09699: Paired_CXXCH_1" amino acids 74 to 124 (51 residues), 21 bits, see alignment 7.5e-08 amino acids 135 to 171 (37 residues), 21 bits, see alignment 7.8e-08 amino acids 181 to 221 (41 residues), 40.9 bits, see alignment 4.5e-14 amino acids 228 to 265 (38 residues), 45.6 bits, see alignment 1.5e-15 PF22678: Cytochrom_c_NrfB-like" amino acids 80 to 155 (76 residues), 51.1 bits, see alignment E=5.5e-17 TIGR01905: doubled CXXCH domain" amino acids 188 to 220 (33 residues), 30.7 bits, see alignment 2.2e-11 amino acids 228 to 265 (38 residues), 38.6 bits, see alignment 7.6e-14

Best Hits

Swiss-Prot: 68% identical to MTRA_SHEB8: Multiheme cytochrome MtrA (mtrA) from Shewanella baltica (strain OS185)

KEGG orthology group: None (inferred from 100% identity to son:SO_1782)

Predicted SEED Role

"periplasmic decaheme cytochrome c, MtrD"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EG30 at UniProt or InterPro

Protein Sequence (306 amino acids)

>SO1782 decaheme cytochrome c MtrD (NCBI ptt file) (Shewanella oneidensis MR-1)
MLTLMLSILSLSTLATPWDDKSSEEVVATLDKKFAEGKYSAKGADTCLMCHKKSAVVMAI
FDGVHGNPNIKDSPMADLQCEACHGPLGNHNKGGKEPMITFGQNSPVPAQKQNSVCMSCH
NDDQRIAWKGNHHDNADIPCSSCHQVHVAKDPISDKANEVAICTQCHSQQKADMHKRSSH
PLQWQQMVCSDCHNPHGSLNDASLKQMTVNENCYSCHAEKRGPKLWEHAPVTDNCANCHN
PHGSVNESMLISKPPQLCQQCHASDGHSSNAYFGNQTNAFTSGNSCMNCHGQVHGSNHPS
GKLLQR