Protein Info for SO1776 in Shewanella oneidensis MR-1

Name: mtrB
Annotation: outer membrane protein precursor MtrB (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 697 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details TIGR03509: decaheme-associated outer membrane protein, MtrB/PioB family" amino acids 53 to 697 (645 residues), 814.9 bits, see alignment E=3e-249 PF11854: MtrB_PioB" amino acids 61 to 697 (637 residues), 820 bits, see alignment E=8.2e-251

Best Hits

Swiss-Prot: 88% identical to MTRB_SHEB8: Outer membrane protein MtrB (mtrB) from Shewanella baltica (strain OS185)

KEGG orthology group: None (inferred from 100% identity to son:SO_1776)

Predicted SEED Role

"outer membrane protein, MtrB"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8CVD4 at UniProt or InterPro

Protein Sequence (697 amino acids)

>SO1776 outer membrane protein precursor MtrB (NCBI ptt file) (Shewanella oneidensis MR-1)
MKFKLNLITLALLANTGLAVAADGYGLANANTEKVKLSAWSCKGCVVETGTSGTVGVGVG
YNSEEDIRSANAFGTSNEVAGKFDADLNFKGEKGYRASVDAYQLGMDGGRLDVNAGKQGQ
YNVNVNYRQIATYDSNSALSPYAGIGGNNLTLPDNWITAGSSNQMPLLMDSLNALELSLK
RERTGLGFEYQGESLWSTYVNYMREEKTGLKQASGSFFNQSMMLAEPVDYTTDTIEAGVK
LKGDRWFTALSYNGSIFKNEYNQLDFENAFNPTFGAQTQGTMALDPDNQSHTVSLMGQYN
DGSNALSGRILTGQMSQDQALVTDNYRYANQLNTDAVDAKVDLLGMNLKVVSKVSNDLRL
TGSYDYYDRDNNTQVEEWTQISINNVNGKVAYNTPYDNRTQRFKVAADYRITRDIKLDGG
YDFKRDQRDYQDRETTDENTVWARLRVNSFDTWDMWVKGSYGNRDGSQYQASEWTSSETN
SLLRKYNLADRDRTQVEARITHSPLESLTIDVGARYALDDYTDTVIGLTESKDTSYDANI
SYMITADLLATAFYNYQTIESEQAGSSNYSTPTWTGFIEDQVDVVGAGISYNNLLENKLR
LGLDYTYSNSDSNTQVRQGITGDYGDYFAKVHNINLYAQYQATEKLALRFDYKIENYKDN
DAANDIAVDGIWNVVGFGSNSHDYTAQMLMLSMSYKL