Protein Info for SO1774 in Shewanella oneidensis MR-1

Annotation: hypothetical Sugar diacid utilization regulator (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 407 PF05651: Diacid_rec" amino acids 4 to 137 (134 residues), 178.2 bits, see alignment E=9.4e-57 PF17853: GGDEF_2" amino acids 143 to 291 (149 residues), 54.8 bits, see alignment E=1.7e-18 PF13556: HTH_30" amino acids 342 to 396 (55 residues), 65.8 bits, see alignment 3.6e-22

Best Hits

KEGG orthology group: K02647, carbohydrate diacid regulator (inferred from 100% identity to son:SO_1774)

Predicted SEED Role

"Sugar diacid utilization regulator SdaR" in subsystem D-galactarate, D-glucarate and D-glycerate catabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EG37 at UniProt or InterPro

Protein Sequence (407 amino acids)

>SO1774 hypothetical Sugar diacid utilization regulator (NCBI ptt file) (Shewanella oneidensis MR-1)
MYLLDSTIAKKIVSRTMKIIGHNINVMNGQGVILGSGDPKRIGSTHEGALLAIAQNRNVE
LSDEVASGLHGVKPGINLPLHYQGQIIGVIGITGAPDELAHYGELLKMTAEMIVEQANQQ
DKLQWENRQREEFILQLIKANTDDEQLQRWAKQLDIDINLPRVAAIIEISEKLSAPIHKT
ASLINAAASESSVDERNPRVSETLKQVLHLLQNPDRGNLIAMTSMSQLVILKPAFLDGKQ
WDPELENQRIDKLLQRLPAQMGLHFKIALGHFFPEKGGIARSYQTAQETLNLGKQLNPEG
TKYLFEDYSLQVLLSGLKHDWRGQALASPYQQLTQADKNGQLRKTLAAYITHFGDAQQCA
NALFIHRNTLRYRLDKIQQLTQTDIQSLHGLLSLYLGQLLDTSANPR