Protein Info for SO1770 in Shewanella oneidensis MR-1

Annotation: glycerate kinase, putative (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00045: glycerate kinase
  • amino acids 2 to 380 (379 residues), 520.8 bits, E=9.8e-161
• PF02595: Gly_kinase
  • amino acids 3 to 379 (377 residues), 512.4 bits, E=3.4e-158

Best Hits

Swiss-Prot: 56% identical to GLXK2_ECOLI: Glycerate 3-kinase (glxK) from Escherichia coli (strain K12)

KEGG orthology group: K00865, glycerate kinase [EC: 2.7.1.31] (inferred from 100% identity to son:SO_1770)

MetaCyc: 56% identical to glycerate 2-kinase 2 (Escherichia coli K-12 substr. MG1655)
GKI-RXN [EC: 2.7.1.165]

Predicted SEED Role

"Glycerate kinase (EC 2.7.1.31)" in subsystem Allantoin Utilization or D-galactarate, D-glucarate and D-glycerate catabolism or Glycerolipid and Glycerophospholipid Metabolism in Bacteria or Glycine and Serine Utilization or Photorespiration (oxidative C2 cycle) or Serine-glyoxylate cycle (EC 2.7.1.31)

MetaCyc Pathways

• photorespiration II (8/10 steps found)
• photorespiration I (7/9 steps found)
• photorespiration III (7/9 steps found)
• glycolate and glyoxylate degradation I (3/4 steps found)
• superpathway of glycol metabolism and degradation (5/7 steps found)
• 2-O-α-mannosyl-D-glycerate degradation (1/2 steps found)
• D-glucarate degradation I (2/4 steps found)
• D-galactarate degradation I (2/4 steps found)
• formaldehyde assimilation I (serine pathway) (8/13 steps found)
• Entner-Doudoroff pathway II (non-phosphorylative) (5/9 steps found)
• superpathway of D-glucarate and D-galactarate degradation (2/5 steps found)
• 2-deoxy-D-ribose degradation II (4/8 steps found)
• superpathway of microbial D-galacturonate and D-glucuronate degradation (6/31 steps found)

KEGG Metabolic Maps

• Glycerolipid metabolism
• Glycine, serine and threonine metabolism
• Glyoxylate and dicarboxylate metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.31

Use Curated BLAST to search for 2.7.1.165 or 2.7.1.31

Sequence Analysis Tools

See Q8EG40 at UniProt or InterPro

Protein Sequence (384 amino acids)

>SO1770 glycerate kinase, putative (NCBI ptt file) (Shewanella oneidensis MR-1)
MKIVIAPDSFKESLSALDVANAIEQGLMQVIPDCEIVKIPVADGGEGTVQSMVDATGGSI
VSLEVMGPLGHKVNAHYGILGQQTAQQTQPIAVIEMASASGLHHVPREQRNPLLTTSYGT
GELICDALNRGIKHIIVGLGGSATNDGGAGMAQALGILLLDKHGKSLSAGGAALAKLANI
DMSNAHPLLKECTFEVACDVDNPLCGERGASAIFGPQKGATAEMVNTLDSALSHYADVIA
QSGVTDHRHQAGAGAAGGMGLGVMAFLGAELRPGVEIVMQTVGLADKIRGADLVITGEGR
IDGQTIFGKTPMGVLKQAQLQNIPTIGIAGCLGDNANAVLEQGMAAIFPIIPHLSPLDDV
LANAKTNLINTARNIGAVLMLGQR