Protein Info for SO1769 in Shewanella oneidensis MR-1

Annotation: glutamate decarboxylase, putative (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 533 TIGR03799: putative pyridoxal-dependent aspartate 1-decarboxylase" amino acids 1 to 516 (516 residues), 952.2 bits, see alignment E=3e-291 PF00282: Pyridoxal_deC" amino acids 52 to 427 (376 residues), 160.3 bits, see alignment E=9e-51 PF00266: Aminotran_5" amino acids 202 to 415 (214 residues), 23.9 bits, see alignment E=3e-09 PF01212: Beta_elim_lyase" amino acids 204 to 351 (148 residues), 29.1 bits, see alignment E=9.2e-11

Best Hits

KEGG orthology group: K01580, glutamate decarboxylase [EC: 4.1.1.15] (inferred from 100% identity to son:SO_1769)

Predicted SEED Role

"Glutamate decarboxylase, eukaryotic type (EC 4.1.1.15)" (EC 4.1.1.15)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.1.15

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EG41 at UniProt or InterPro

Protein Sequence (533 amino acids)

>SO1769 glutamate decarboxylase, putative (NCBI ptt file) (Shewanella oneidensis MR-1)
MRIFTVPEDADSTLSIIEQKLSEDLAGFLGDSIAALEKPLSEIETDFQTFEIPNQPRFVS
DYTDEIMQNLVAHSVHTAAPSFIGHMTSALPYFVLPLSKMMVGLNQNLVKIETSKAFTPL
ERQVLGMMHHLIYAQHDDFYRNWMHSANHSLGAFCSGGTVANITALWIARNQLLKADGDF
KGVTREGLIKALRHYDYDDLAILVSERGHYSLGKAVDLLGIGRDNIISIPTDADNKVDVT
QMRKIAVELAHKRIKVMAIVGVAGTTETGNIDPLKQLAALASELNCHFHVDAAWGGASLL
SNKYRHLLDGVELADSVTIDAHKQMYVPMGAGMVLFKNPEFAHAIAHHAEYILRRGSKDL
GSQTLEGSRPGMAMLVHACLQIIGRDGYEILINNSLEKARYFAEQIDAHPDFELVTAPEL
CLLTYRYVPASVQAAMQVAIEQGDKAKLERFNEQLDGLTQFIQKHQREQGKSFVSRTRIQ
PARYFRQPTVVFRVVLANPLTSHEILNQVLIEQGEIATLDKEFLPALLAMVAE