Protein Info for SO1750 in Shewanella oneidensis MR-1

Annotation: ABC transporter, ATP-binding protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 292 PF00005: ABC_tran" amino acids 18 to 162 (145 residues), 105.9 bits, see alignment E=2.7e-34

Best Hits

KEGG orthology group: K01990, ABC-2 type transport system ATP-binding protein (inferred from 100% identity to son:SO_1750)

Predicted SEED Role

"ABC transporter ATP-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EG59 at UniProt or InterPro

Protein Sequence (292 amino acids)

>SO1750 ABC transporter, ATP-binding protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MLTITDLTKTYDNGVRALDGVNLTISKGMFGLLGPNGAGKSSLMRTIAALQSADSGSIVF
DGIDVLADPQSLRKTLGYLPQDFNVYPRISAYDLLDHLAVLKGINQSKQRKEIVEGLLAH
TNLYQHKSKAVSGFSGGMRQRFGIAQALLGDPKLLIVDEPTAGLDPEERNRFHNLLVSLG
EEKVVILSTHIVEDVSELCANMAVLASGKILLQGNPQQLVSELTEKIWTKTVDQAEAQQL
ENTLPVISKRLLAGRTVLNVMAETCPEGFTPAAAGLEDLYFSTLHSHRHQAA