Protein Info for SO1747 in Shewanella oneidensis MR-1

Annotation: membrane protein, putative (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 325 transmembrane" amino acids 13 to 34 (22 residues), see Phobius details amino acids 46 to 66 (21 residues), see Phobius details amino acids 86 to 104 (19 residues), see Phobius details amino acids 111 to 133 (23 residues), see Phobius details amino acids 139 to 157 (19 residues), see Phobius details amino acids 207 to 231 (25 residues), see Phobius details amino acids 237 to 257 (21 residues), see Phobius details amino acids 269 to 287 (19 residues), see Phobius details amino acids 299 to 319 (21 residues), see Phobius details TIGR03718: integral membrane protein, TerC family" amino acids 12 to 322 (311 residues), 405.2 bits, see alignment E=1e-125 PF03741: TerC" amino acids 77 to 282 (206 residues), 186.9 bits, see alignment E=1.5e-59

Best Hits

KEGG orthology group: None (inferred from 100% identity to son:SO_4279)

Predicted SEED Role

"Integral membrane protein TerC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EG61 at UniProt or InterPro

Protein Sequence (325 amino acids)

>SO1747 membrane protein, putative (NCBI ptt file) (Shewanella oneidensis MR-1)
MEFFTTLFVGYPMWVWLMFFGFVLALLAFDLGVLHKEQHEITVAESLKLSAFYICMGLLF
GAWLWWYKGSTAGMEYLTGYLIEKSLSMDNVFVIALIFSSLGIPRLYQHRVLFWGIMGVI
VLRAIMIGLGAALVAQYQGVLVLFGLFLIFTGIKMLFSNDEHGDIQDNKFYKWLRSKMRF
TPSLHQEKFWVRGEDHQLSKGWWATPLFLALILVETADLVFAVDSIPAIFAITQDPFIVY
TSNIFAILGLRALYFALAAMVHRFEYLKYALSVVLVFIGVKVGLVYFNHEGIVDFKIPTA
LSLGVTFGLLLAGVLFSLWKTREQK