Protein Info for SO1745 in Shewanella oneidensis MR-1

Annotation: 3-beta hydroxysteroid dehydrogenase/isomerase family protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 387 PF01370: Epimerase" amino acids 57 to 274 (218 residues), 110.5 bits, see alignment E=3.7e-35 PF02719: Polysacc_synt_2" amino acids 57 to 163 (107 residues), 25.4 bits, see alignment E=3.1e-09 PF04321: RmlD_sub_bind" amino acids 57 to 207 (151 residues), 38.4 bits, see alignment E=3.1e-13 PF16363: GDP_Man_Dehyd" amino acids 57 to 381 (325 residues), 47.7 bits, see alignment E=6.2e-16 PF05368: NmrA" amino acids 58 to 165 (108 residues), 30.1 bits, see alignment E=1.4e-10 PF01073: 3Beta_HSD" amino acids 58 to 306 (249 residues), 194.6 bits, see alignment E=7.7e-61 PF13460: NAD_binding_10" amino acids 60 to 200 (141 residues), 63 bits, see alignment E=1.4e-20 PF07993: NAD_binding_4" amino acids 105 to 209 (105 residues), 37.3 bits, see alignment E=7e-13

Best Hits

Swiss-Prot: 100% identical to OLED_SHEON: 2-alkyl-3-oxoalkanoate reductase (oleD) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: None (inferred from 100% identity to son:SO_1745)

MetaCyc: 100% identical to hentriaconta-3,6,9,12,19,22,25,28-octaene-16-one-15-oate reductase (Shewanella oneidensis MR-1)
RXN-18561 [EC: 1.1.1.412]

Predicted SEED Role

"NAD(P)H steroid dehydrogenase-like protein in alkane synthesis cluster"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.412

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EG63 at UniProt or InterPro

Protein Sequence (387 amino acids)

>SO1745 3-beta hydroxysteroid dehydrogenase/isomerase family protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MTDNSSISLTPADLEHVPLQPTRLKQVGGDQACIKLSLDAREQTALDALAAKVSHAFVTG
AGGFLGKAICQRLIAAGIKVTGFARGRYLELEALGVTMVQGDLVNPEQVKQAMQGCDIVF
HVASKAGVWGDRDSYFCPNVKGAANVIAACKALKINKLVYTSTPSVTFAGEDESGINEST
PYASRFLNYYAHSKAIAEKMMLDANQSSSTNAAYVLKTVALRPHLIWGPNDPHLVPRVLA
RGRLGKLKLVGREDKLVDTIYIDNAAYAHVLAALELCQATPKCQGKAYFISNDEPVTMAK
MLNMILACDGLPPVTQRVPQMLAYAVGAVLETAYRLLNKQEEPIMTRFVAKQLSCSHYFD
ISAAKQDFGYSALVSIEEGMKRLKASL