Protein Info for SO1744 in Shewanella oneidensis MR-1

Annotation: AMP-binding protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 614 transmembrane" amino acids 101 to 101 (1 residues), see Phobius details amino acids 103 to 124 (22 residues), see Phobius details PF00501: AMP-binding" amino acids 60 to 452 (393 residues), 160.8 bits, see alignment E=2.3e-51

Best Hits

Swiss-Prot: 100% identical to OLEC_SHEON: Olefin beta-lactone synthetase (oleC) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: None (inferred from 100% identity to son:SO_1744)

MetaCyc: 100% identical to olefin beta-lactone synthetase (Shewanella oneidensis MR-1)
RXN-18562 [EC: 6.1.3.1]

Predicted SEED Role

"AMP-dependent synthetase/ligase in alkane synthesis cluster"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.1.3.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EG64 at UniProt or InterPro

Protein Sequence (614 amino acids)

>SO1744 AMP-binding protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MTKVDDALFEHGASAVAVEQNNGRDNPTKPKDANICRHLKLAAHHIPHHLAVAVQQGKGK
SFANLTYQELDFISLNKQSDAIAFALNAYGLTRGMKAVLMVTPSLDFFALTFALFKAGII
PVLVDPGMGIKNLKQCFIEAAPDAFIGIPKAHIARRLLGWGKASVKRLINVDANQSGVTD
TLSRLLTGAPSLASMLSFTTKSSSAKLPEQVEYPMALLEHDEMAAILFTSGSTGTPKGVV
YSHGMFEAQIQALKQDYGIAHGERDLATFPLFSLFGPALGMTSIVPEMDASKPITANPEF
LFAAIEKYQCSNIFVNPALLERLGRAGEQTDSKNQHKLSSVKRVISAGAPATIASIARFS
KMLSDGVPVLNSYGATESLPISMIASDELFTTTQVTDNGGGICVGRAIDGVKIEIIAITE
ADIPEWDNRLCLNAGEIGEIVVTGQMVSQSYYHREKATAASKIWDSERQTFRHRMGDLGY
LDDSGRLWMCGRKAHRVDATQGGQFAKRYYSIPCERIFNTHPNVKRSALVGVTVKGQHGV
GEIKPLICIELDQSLVCNKSAQLYQELMVIAEQYSQTQGIRRFLIHPDFPVDVRHNAKIF
REKLAVWAQSQTKG