Protein Info for SO1720 in Shewanella oneidensis MR-1

Annotation: DedA family protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 217 transmembrane" amino acids 19 to 38 (20 residues), see Phobius details amino acids 43 to 63 (21 residues), see Phobius details amino acids 69 to 92 (24 residues), see Phobius details amino acids 113 to 132 (20 residues), see Phobius details amino acids 137 to 141 (5 residues), see Phobius details amino acids 152 to 175 (24 residues), see Phobius details amino acids 187 to 211 (25 residues), see Phobius details PF09335: VTT_dom" amino acids 48 to 172 (125 residues), 86.1 bits, see alignment E=1.4e-28

Best Hits

Swiss-Prot: 35% identical to YGHB_SALTY: Inner membrane protein YghB (yghB) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K03975, membrane-associated protein (inferred from 100% identity to son:SO_1720)

Predicted SEED Role

"DedA protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EG87 at UniProt or InterPro

Protein Sequence (217 amino acids)

>SO1720 DedA family protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MDQLYQLAQAMIHNDLAVLSNPNVTLMVSGVILCFLVMENGFIPTAFLPGDTLLILTGVL
IYQDVLHMGIVPLLMVATFIGTAIGYLQGYFLGHTQMYHRLLSHIDDKHQKKALYLIDKY
GILTLLVARYIPFVRTIYPYIIGATGVSWSRFLVINFISSVMWITPLVGFGYVISHSKLA
NEYQTQFMSIIVYLPIVLLVSGIVTLIYKWLRKKKKL