Protein Info for SO1695 in Shewanella oneidensis MR-1

Annotation: sensory box/GGDEF family protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 318 TIGR00229: PAS domain S-box protein" amino acids 22 to 148 (127 residues), 38.8 bits, see alignment E=8.9e-14 PF24820: Diguanyl_cycl_sensor" amino acids 28 to 137 (110 residues), 153.8 bits, see alignment E=1.5e-49 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 148 to 315 (168 residues), 158.9 bits, see alignment E=9.4e-51 PF00990: GGDEF" amino acids 152 to 313 (162 residues), 144.4 bits, see alignment E=2.7e-46

Best Hits

KEGG orthology group: None (inferred from 100% identity to son:SO_1695)

Predicted SEED Role

"FIG01057498: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EGB0 at UniProt or InterPro

Protein Sequence (318 amino acids)

>SO1695 sensory box/GGDEF family protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MPTTKQLKDTELPLNFFEHSSLETIELFIQHLTEAMILVNANGFIRSCNQRSAELLDCPQ
VSLKGQDWRNFLTEHHQARYDNLLSHDVQLGTNCGQPVQHPAQETTLICASGKAKDVELS
ISYIPGHEPMFVMVMHDLTHHKAENQKLRKLAATDSLTQLANRRYFDEMLQQHWEECTAK
LRPISVVIIDVDYFKVFNDQFGHIQGDECLRKIAKVIAGIVPTEIGLAARYGGEEFALIL
PNHNAKMALTIAQKIQQGINNIRFTDQGLRDYVSVSASQGIACEVNGQFRTSLAMVCAAD
TALYRAKADGRDRINTSL