Protein Info for SO1691 in Shewanella oneidensis MR-1

Name: blc
Annotation: lipoprotein Blc (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 177 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details PF08212: Lipocalin_2" amino acids 30 to 170 (141 residues), 147.2 bits, see alignment E=3.4e-47 PF00061: Lipocalin" amino acids 36 to 171 (136 residues), 43.9 bits, see alignment E=2.8e-15

Best Hits

Swiss-Prot: 66% identical to BLC_VIBCH: Outer membrane lipoprotein Blc (blc) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K03098, outer membrane lipoprotein Blc (inferred from 100% identity to son:SO_1691)

Predicted SEED Role

"lipoprotein Blc"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EGB4 at UniProt or InterPro

Protein Sequence (177 amino acids)

>SO1691 lipoprotein Blc (NCBI ptt file) (Shewanella oneidensis MR-1)
MKKLLLMISVLVLTGCLGMPNYVEPVKDFELDRYLGKWYEIARLDHSFERGLTQVTAEYS
LKPDGGVKVINRGYSAAKQQWKEAEGKAYFVNGENEAYLKVSFFGPFYGAYVVFGLDQQN
YQYAFISGPDTDYLWLLARTPTVSPEVIQQFVDMAKAKGFDTDSLIYVEQKPTEVKQ