Protein Info for SO1686 in Shewanella oneidensis MR-1

Annotation: prolyl oligopeptidase family protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 678 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details PF20434: BD-FAE" amino acids 426 to 617 (192 residues), 40.6 bits, see alignment E=2.2e-14 PF00326: Peptidase_S9" amino acids 452 to 658 (207 residues), 145.9 bits, see alignment E=1.2e-46

Best Hits

KEGG orthology group: None (inferred from 100% identity to son:SO_1686)

Predicted SEED Role

"prolyl oligopeptidase family protein" in subsystem Synechocystis experimental

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EGB8 at UniProt or InterPro

Protein Sequence (678 amino acids)

>SO1686 prolyl oligopeptidase family protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MGLGRYLPYLLSAALLLLCGCERTDTHAQPAKENGEIKVAPYGSWQSPLSAADVFKQTDD
IAELQSVGNAIYFAESSGRDQGKVGIKRLDGLGKVTQVVLPDFNVKSTVHEYGGAAFLGI
GKSLFATKMQDQLFYRFAPNQPPLPLTPNGTRHADCVAYPKGSRIICVREDHRQGGEPKA
SLVTINLNFAGEGDTFVSGHDFISSPTISPDNTQLAWITWEHPYMPWDNSVLWLGELDRK
GQLKNVRKVSTPEASSVAQPLFGPDGKLYVVSDISNWWNIYRVTPSYTLEPVLSKNAEFA
VPDWRLGNHNYAFENATTLIASYVEGNRAALLRIHLDSELTESLAIDFAEITQVVKGEDG
VYFVGAKATPEKGIYRVVGRGTELVYAPALANLNPNYVSRAINIAFATGKDQQAYGYFYG
PVNPKYVPPHDTRPPLIVMLHGGPTSRASLAYRSEIQFWTSRGFAVLDLNFRGSSGFGRA
YRQSLYGKWGESDVEDAVNAAKYLVAKGWVDANKLAIRGISAGGLTVMSSLAFYNVFQAG
VSYEGISDVEQLAKSTHKFESGYLDQLIGPYPENTDRYRELSPLNHLDGLNEPLLIFQSL
RNKIVPTSQSRQIYDALKAKGVPTAYIDYGDDSDEGRTPEHKAAGLETELAFYGQVFKFT
PAGKLPPLILDNISALTP