Protein Info for SO1678 in Shewanella oneidensis MR-1

Name: mmsA
Annotation: methylmalonate-semialdehyde dehydrogenase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 499 TIGR01722: methylmalonate-semialdehyde dehydrogenase (acylating)" amino acids 5 to 481 (477 residues), 817 bits, see alignment E=2.4e-250 PF00171: Aldedh" amino acids 16 to 477 (462 residues), 464.9 bits, see alignment E=1.3e-143

Best Hits

Swiss-Prot: 74% identical to MMSA_PSEAE: Methylmalonate-semialdehyde dehydrogenase [acylating] (mmsA) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K00140, methylmalonate-semialdehyde dehydrogenase [EC: 1.2.1.27] (inferred from 100% identity to son:SO_1678)

MetaCyc: 74% identical to methylmalonate-semialdehyde dehydrogenase subunit (Pseudomonas aeruginosa)
Methylmalonate-semialdehyde dehydrogenase (acylating). [EC: 1.2.1.27]

Predicted SEED Role

"Methylmalonate-semialdehyde dehydrogenase (EC 1.2.1.27)" in subsystem Isobutyryl-CoA to Propionyl-CoA Module or Valine degradation (EC 1.2.1.27)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.2.1.27

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EGC6 at UniProt or InterPro

Protein Sequence (499 amino acids)

>SO1678 methylmalonate-semialdehyde dehydrogenase (NCBI ptt file) (Shewanella oneidensis MR-1)
MTTQVKHYIDGEFTAGTGTSQIVVTNPANNATIAVINSATADEVHAAIASAKAAFKTWKE
VPVSERARVMLRYQHLLKEHHDELATILAHETGKTFEDAKGDVWRGIEVAEHACNIASLL
MGETVENVARSIDTYSYTQPLGVCAGITPFNFPAMIPLWMFPLAIACGNTFILKPSEQDP
MTPQRLVELFVEAGAPKGVLQLIHGDKTAVDILLADPAVKAISFVGSVAVGQYIYKTGTD
NLKRVQAFAGAKNHCVIMPDANKQQVINNLVGASVGAAGQRCMAISVAVFVGAAKEWIPE
LKEALAKVRPGLWDDKDAGYGPLISPAAKVRVLKLIAQGKEEGAQCLLDGSDFTVAGFES
GNWVGPTMFTKVTTDMSIYKEEIFGPVLCCMESDSLEDAIELVNASPYGNGTSIFTASGA
AARKYQHEIEVGQVGINVPIPVPLPFFSFTGWKGSFYGDQHAYGKQAVRFYTETKTITAR
WFESDIAVAAGPNMSINLR