Protein Info for SO1676 in Shewanella oneidensis MR-1

Name: metA
Annotation: homoserine O-succinyltransferase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 313 transmembrane" amino acids 135 to 155 (21 residues), see Phobius details TIGR01001: homoserine O-succinyltransferase" amino acids 1 to 301 (301 residues), 466.8 bits, see alignment E=1.9e-144 PF04204: HTS" amino acids 2 to 299 (298 residues), 454.2 bits, see alignment E=8.2e-141

Best Hits

Swiss-Prot: 100% identical to METAS_SHEON: Homoserine O-succinyltransferase (metAS) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K00651, homoserine O-succinyltransferase [EC: 2.3.1.46] (inferred from 100% identity to son:SO_1676)

MetaCyc: 54% identical to homoserine O-succinyltransferase (Escherichia coli K-12 substr. MG1655)
Homoserine O-succinyltransferase. [EC: 2.3.1.46]

Predicted SEED Role

"Homoserine O-succinyltransferase (EC 2.3.1.46)" in subsystem Methionine Biosynthesis (EC 2.3.1.46)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.46

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EGC8 at UniProt or InterPro

Protein Sequence (313 amino acids)

>SO1676 homoserine O-succinyltransferase (NCBI ptt file) (Shewanella oneidensis MR-1)
MPVKIPDHLPAAGILESENIFVMSETRAANQDIRPMKVLILNLMPNKIETETQLLRLLGN
TPLQVDVDLLRIHDKESKHTSIDHMNTFYRDFEDVRHKNYDGLIITGAPLGQIDFEDVTY
WDHIREIIDWSQQHVTSVLFLCWAAHAGLYHLYGLNRKILEQKRSGVFVHRRTCQHFPLL
RGFDDEFFAPHSRFAEMDVEEIRQHPQLQLLAESDEAGAYLVLSRNNRNLFVMGHPEYQK
STLNDEYHRDLAQSLNPNVPQNYYRNDDPKADAIARWHSHGSLLVSNWLNYYVYQLTPYD
LSDMTAMTPWESQ