Protein Info for SO1673 in Shewanella oneidensis MR-1

Annotation: outer membrane protein OmpW, putative (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 214 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF13505: OMP_b-brl" amino acids 12 to 214 (203 residues), 51.2 bits, see alignment E=3.4e-17 PF03922: OmpW" amino acids 27 to 214 (188 residues), 224.6 bits, see alignment E=2.3e-70 PF05736: OprF" amino acids 56 to 145 (90 residues), 26.6 bits, see alignment E=9.8e-10 PF02462: Opacity" amino acids 112 to 182 (71 residues), 24.7 bits, see alignment E=4.2e-09

Best Hits

Swiss-Prot: 54% identical to OMPW_VIBCH: Outer membrane protein W (ompW) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K07275, outer membrane protein (inferred from 100% identity to son:SO_1673)

Predicted SEED Role

"Outer membrane protein W precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EGD1 at UniProt or InterPro

Protein Sequence (214 amino acids)

>SO1673 outer membrane protein OmpW, putative (NCBI ptt file) (Shewanella oneidensis MR-1)
MNKTTVSTLIAATLLAAGFSASVSAHQAGDIIVRAGAVVVAPNESSDDVAGNGEFQISNN
TQLGLNFGYMLTDNFGVELLAATPFSHDVSLAGIGKIAETKHLPPTLVAQYYFGNAQSTL
RPYVGVGVNYTNFFDNEFTNDLNGALTDLSMSTSWGLAAQVGLDYQVNKNWLVNASVWYA
QISTDVEFKLGGKPVTIETDINPWVYMVSVGYTF