Protein Info for SO1670 in Shewanella oneidensis MR-1

Updated annotation (from data): fumarylacetoacetate hydrolase (EC 3.7.1.2)
Rationale: Important for utilization of phenylalanine (which is catabolized via tyrosine due to phenylalanine-4-hydroxylase SO1666) , gelatin, or CASamino acids. This protein encodes the missing fumarylacetaectate hydrolase.
Original annotation: fumarylacetoacetate hydrolase family protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 328 PF18288: FAA_hydro_N_2" amino acids 1 to 78 (78 residues), 100 bits, see alignment E=8.7e-33 PF01557: FAA_hydrolase" amino acids 82 to 323 (242 residues), 122.5 bits, see alignment E=2e-39

Best Hits

KEGG orthology group: None (inferred from 100% identity to son:SO_1670)

Predicted SEED Role

"Fumarylacetoacetate hydrolase family protein" in subsystem Gentisare degradation or Salicylate and gentisate catabolism

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.7.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EGD4 at UniProt or InterPro

Protein Sequence (328 amino acids)

>SO1670 fumarylacetoacetate hydrolase (EC 3.7.1.2) (Shewanella oneidensis MR-1)
MKLASYNNGRRDGQLMLVSRDLTQTVAVPAIAHTMQQLLDGWELLKPQLQELYDALNEGK
LPNTQTFDETKCLSPLPRAYQWADGSAYVNHVELVRKARGAEMPETFWTDPLFYQGGSDS
FIAPKADIPLASEDWGIDFESEIAVITDDVPMGVSAENAAKHIKLLMLVNDVSLRNLIPA
ELAKGFGFFQSKPSSSFSPVAITPDELGHRWEDSKVHLPLITYLNGELFGRPNAGVDMTF
NFSQLVSHVAKTRPLGAGAIIGSGTISNYDRSAGSSCLAEKRMLEVIADGKASTPFMRFG
DTVRIEMLDDNGVSIFGSIDQKVVEYKA