Protein Info for SO1667 in Shewanella oneidensis MR-1

Annotation: pterin-4-alpha-carbinolamine dehydratase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 100% identical to PHS_SHEON: Putative pterin-4-alpha-carbinolamine dehydratase (SO_1667) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K01724, 4a-hydroxytetrahydrobiopterin dehydratase [EC: 4.2.1.96] (inferred from 96% identity to shn:Shewana3_2780)

Predicted SEED Role

"Pterin-4-alpha-carbinolamine dehydratase (EC 4.2.1.96)" in subsystem Pterin biosynthesis (EC 4.2.1.96)

MetaCyc Pathways

L-phenylalanine degradation V (3/3 steps found)
tetrahydropteridine recycling (2/2 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.96

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EGD7 at UniProt or InterPro

Protein Sequence (112 amino acids)

>SO1667 pterin-4-alpha-carbinolamine dehydratase (NCBI ptt file) (Shewanella oneidensis MR-1)
MTALTQMKCEACQADAPKVTDEELAELIRMIPDWGVQVRDGIMQLERVYKFKNFKLAMAF
TNKLAELAEEEFHHPGILTEWGKVTVTWWSHSIKGLHKNDFIMAAKTDLLLD