Protein Info for SO1664 in Shewanella oneidensis MR-1

Name: galE
Annotation: UDP-glucose 4-epimerase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 337 PF04321: RmlD_sub_bind" amino acids 1 to 165 (165 residues), 45.6 bits, see alignment E=2.5e-15 PF00106: adh_short" amino acids 2 to 113 (112 residues), 33.7 bits, see alignment E=1.3e-11 PF08659: KR" amino acids 2 to 131 (130 residues), 36.7 bits, see alignment E=2.1e-12 PF01370: Epimerase" amino acids 3 to 261 (259 residues), 198.5 bits, see alignment E=6.1e-62 PF02719: Polysacc_synt_2" amino acids 3 to 183 (181 residues), 60.2 bits, see alignment E=1e-19 TIGR01179: UDP-glucose 4-epimerase GalE" amino acids 3 to 334 (332 residues), 475.5 bits, see alignment E=3.6e-147 PF16363: GDP_Man_Dehyd" amino acids 4 to 321 (318 residues), 202.6 bits, see alignment E=6.1e-63 PF01073: 3Beta_HSD" amino acids 4 to 157 (154 residues), 60.3 bits, see alignment E=8e-20 PF07993: NAD_binding_4" amino acids 5 to 174 (170 residues), 35.9 bits, see alignment E=2.4e-12 PF13460: NAD_binding_10" amino acids 7 to 177 (171 residues), 29.4 bits, see alignment E=3.6e-10

Best Hits

Swiss-Prot: 69% identical to GALE_BACSU: UDP-glucose 4-epimerase (galE) from Bacillus subtilis (strain 168)

KEGG orthology group: K01784, UDP-glucose 4-epimerase [EC: 5.1.3.2] (inferred from 100% identity to son:SO_1664)

MetaCyc: 69% identical to UDP-glucose 4-epimerase (Bacillus subtilis subtilis 168)
UDP-N-acetylglucosamine 4-epimerase. [EC: 5.1.3.7]; UDP-glucose 4-epimerase. [EC: 5.1.3.7, 5.1.3.2]

Predicted SEED Role

"UDP-glucose 4-epimerase (EC 5.1.3.2)" in subsystem Lacto-N-Biose I and Galacto-N-Biose Metabolic Pathway or Lactose and Galactose Uptake and Utilization or N-linked Glycosylation in Bacteria or Rhamnose containing glycans or linker unit-arabinogalactan synthesis (EC 5.1.3.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 5.1.3.2, 5.1.3.7

Use Curated BLAST to search for 5.1.3.2 or 5.1.3.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EGE0 at UniProt or InterPro

Protein Sequence (337 amino acids)

>SO1664 UDP-glucose 4-epimerase (NCBI ptt file) (Shewanella oneidensis MR-1)
MTILVTGGAGYIGTHTVVELLNAGSEVIVLDNLSNSSIEALDRVERITGKSVTFYQGDIL
NKALLQKVFSDHSIDAVIHFAGLKAVGESVAKPLKYYENNVTGTLILCQVMAEFKVKNLV
FSSSATVYGDPASLPITEDFPTGATNPYGQSKLMVEHILADLHHSDPSWNIARLRYFNPV
GAHASGLIGEDPNDIPNNLMPFIAQVAVGKREALSVFGNDYPTHDGTGVRDYIHVVDLAI
GHLKALEKLATKPGLVTYNLGTGQGYSVLDMVKAFEKACGKSIAYLIAPRRPGDIAACYA
DPDHAKTDLDWQATHSLEDMANSSWHWQSTNPNGYKG