Protein Info for SO1659 in Shewanella oneidensis MR-1

Annotation: decaheme cytochrome c (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 758 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details TIGR03507: decaheme c-type cytochrome, OmcA/MtrC family" amino acids 63 to 753 (691 residues), 548.9 bits, see alignment E=9e-169 PF22113: Mtrc-MtrF_II-IV_dom" amino acids 224 to 380 (157 residues), 65.6 bits, see alignment E=8.7e-22 amino acids 557 to 753 (197 residues), 107.9 bits, see alignment E=8.9e-35

Best Hits

KEGG orthology group: None (inferred from 100% identity to son:SO_1659)

Predicted SEED Role

"Decaheme cytochrome c MtrF"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EGE5 at UniProt or InterPro

Protein Sequence (758 amino acids)

>SO1659 decaheme cytochrome c (NCBI ptt file) (Shewanella oneidensis MR-1)
MKNYNKSLLALALTSALCLTACGDGEDGKDGAPGTPGTPGTPGTPGLPAGSFAKTAESIT
DLKFTLSPADIKVTSSEGFSVKFTLTGKSSGKDVPFMGLDKIAVYSLTANENTSGTGAPI
EWQNNATANKAGSSLTCTLNGLNGTKNACTLKEDAANPGTYTATWTYDGAAPIINPNDNP
NAVHRVFVRAYNIVNSQGVALADKVLSVPVDFIPTTDELAASGKDTVSSAACKNCHGEVD
GHIAKIEAHHNYQDVKNCVTCHNPDLVPSDAQLAEGWVFDFAPMIHRIHAGEHNAAYLSG
EAKEYFGEIGFPSDLKECKSCHDGAPSYNTNIYAQACVGCHINVNFATGENHSEFGLAQA
DDTQCKSCHGSGSLTPEAVHSVGKRAEYADLFKVDFTSAAVVPSATLGMKTLTLKANVSI
NGAPIADGTSLATYHATNNPTGKLVANGLLLGNVATDGTVYAWRDVKPTAISLNLASGTL
SGGVLTFVKDIPDAQAIGTIYVSSEANACIKAGAVTSCNATGLEFGPTNPIGNSSPVKFF
SLDGSAVSTARMADPSRITVEEAKCNACHGTLDYIKGTRHGTYTFTQCMNCHNDTTGASG
HKTVVYKGDDGSKVVNPDVTFNNKDLFTVAHRFHSGNFDSITGIFRNAAGELEGYPSPET
ACSACHKDSAKLFATDGGLTSEKRSIKVGSNYISPVAESCRSCHAHSDAAAVAHFRSNGA
IVEADAVTDSNLPVESCATCHAEGKTYGIDKVHAEVAH