Protein Info for SO1656 in Shewanella oneidensis MR-1

Annotation: ROK family protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00480: ROK
  • amino acids 4 to 306 (303 residues), 273.5 bits, E=2.6e-85
• PF02685: Glucokinase
  • amino acids 7 to 259 (253 residues), 41.9 bits, E=7.1e-15

Best Hits

KEGG orthology group: K00847, fructokinase [EC: 2.7.1.4] (inferred from 100% identity to son:SO_1656)

Predicted SEED Role

"Glucokinase, ROK family (EC 2.7.1.2)" in subsystem Beta-Glucoside Metabolism (EC 2.7.1.2)

MetaCyc Pathways

• Bifidobacterium shunt (14/15 steps found)
• heterolactic fermentation (15/18 steps found)
• glycogen degradation I (7/8 steps found)
• glycolysis III (from glucose) (9/11 steps found)
• glycogen degradation II (5/6 steps found)
• sucrose degradation II (sucrose synthase) (4/5 steps found)
• homolactic fermentation (9/12 steps found)
• superpathway of anaerobic sucrose degradation (14/19 steps found)
• sucrose biosynthesis II (6/8 steps found)
• sucrose degradation III (sucrose invertase) (3/4 steps found)
• sucrose degradation IV (sucrose phosphorylase) (3/4 steps found)
• UDP-N-acetyl-D-galactosamine biosynthesis II (5/7 steps found)
• D-sorbitol degradation I (2/3 steps found)
• GDP-α-D-glucose biosynthesis (2/3 steps found)
• trehalose degradation V (2/3 steps found)
• UDP-N-acetyl-D-glucosamine biosynthesis II (4/6 steps found)
• trehalose degradation I (low osmolarity) (1/2 steps found)
• trehalose degradation II (cytosolic) (1/2 steps found)
• glucose and glucose-1-phosphate degradation (3/5 steps found)
• mannitol cycle (3/5 steps found)
• sucrose degradation I (sucrose phosphotransferase) (1/3 steps found)
• trehalose degradation IV (1/3 steps found)
• 1,3-propanediol biosynthesis (engineered) (5/9 steps found)
• chitin biosynthesis (5/9 steps found)
• sucrose degradation VII (sucrose 3-dehydrogenase) (1/4 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Fructose and mannose metabolism
• Galactose metabolism
• Glycolysis / Gluconeogenesis
• Nucleotide sugars metabolism
• Starch and sucrose metabolism
• Streptomycin biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.2 or 2.7.1.4

Sequence Analysis Tools

See Q8EGE8 at UniProt or InterPro

Protein Sequence (306 amino acids)

>SO1656 ROK family protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MIRMGIDLGGTKIELVALNNEGNEVVRKRINTPRDYQGTLNAIVDLVNEAESTLGEKGSV
GVGIPGVISPYSGLVKNANSTWINGHPLDVHLGELLGREVRVANDANCFALSEAVDGAAA
GKSVVFGVIIGTGCGAGVAINGKVHAGGNGIGGEWGHNPLPWMTKEEFNTTRCFCGNPDC
IETFISGTGFVRDYNEALSRAASVQRVPAKSGSEIMSLVDGGDEIALAAFERYVDRLARS
LAHVINLLDPDAIVLGGGMSNVEAIYPRLPALLSHYVVGRECRTPVVQNLYGCSSGVRGA
AWLWEK