Protein Info for SO1634 in Shewanella oneidensis MR-1

Name: cdsA
Annotation: phosphatidate cytidylyltransferase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 254 transmembrane" amino acids 23 to 44 (22 residues), see Phobius details amino acids 56 to 78 (23 residues), see Phobius details amino acids 93 to 114 (22 residues), see Phobius details amino acids 120 to 143 (24 residues), see Phobius details amino acids 164 to 182 (19 residues), see Phobius details amino acids 188 to 206 (19 residues), see Phobius details amino acids 235 to 253 (19 residues), see Phobius details PF01148: CTP_transf_1" amino acids 2 to 249 (248 residues), 186 bits, see alignment E=6.4e-59

Best Hits

KEGG orthology group: K00981, phosphatidate cytidylyltransferase [EC: 2.7.7.41] (inferred from 100% identity to son:SO_1634)

Predicted SEED Role

"Phosphatidate cytidylyltransferase (EC 2.7.7.41)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 2.7.7.41)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.41

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EGH0 at UniProt or InterPro

Protein Sequence (254 amino acids)

>SO1634 phosphatidate cytidylyltransferase (NCBI ptt file) (Shewanella oneidensis MR-1)
MIAVFLIAAKEWGRIIDSQCNVTQWSFTCTVGILLIALNLIVPADTIWLRGQIHPIYFAV
VTIGALWWMVSLLLVLTYPKSAKLWQKNPMLKSMFGQLTLVPCFVALIALKSISSQISPY
YGASLVLLVMLIVWAADSGAYFVGKAVGKTKLMPAVSPAKTLEGLLGGLVTTLIVVAGVM
VISPEQELGLVVAVTLFVALISALGDLSESMFKRAACIKDSGTILPGHGGVLDRIDSLTA
ALPVFTLIYIAFWM