Protein Info for SO1630 in Shewanella oneidensis MR-1

Name: tsf
Annotation: translation elongation factor Ts (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 283 TIGR00116: translation elongation factor Ts" amino acids 1 to 277 (277 residues), 360.4 bits, see alignment E=3.3e-112 PF00889: EF_TS" amino acids 78 to 260 (183 residues), 195 bits, see alignment E=5.6e-62

Best Hits

Swiss-Prot: 100% identical to EFTS_SHEON: Elongation factor Ts (tsf) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K02357, elongation factor Ts (inferred from 100% identity to son:SO_1630)

Predicted SEED Role

"Translation elongation factor Ts"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EGH4 at UniProt or InterPro

Protein Sequence (283 amino acids)

>SO1630 translation elongation factor Ts (NCBI ptt file) (Shewanella oneidensis MR-1)
MAISAAQVKELRERTGAGMMDCKKALEETNGDMELAIDNMRKSGAAKAAKKAGNIAADGT
ILIKNGEGFAVLLEVNCQTDFVAKDANFLGFANAVLDVAAASKVTLEDLKAQFEEARVAL
VAKIGENINVRRVEYIDGAKLASYRHGERIGVVVTGDADEETLKHLAMHVAASKPEYVNP
EDVPADVVAREQALQIEISMNEGKPADIAEKMVVGRMKKFTGEISLTGQAYIMEPKKTVG
EFLKEKGAKVTNFIRLEVGEGIEKKEEDFAAEVAAQIAASKKA