Protein Info for SO1624 in Shewanella oneidensis MR-1

Name: purU
Annotation: formyltetrahydrofolate deformylase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 271 TIGR00655: formyltetrahydrofolate deformylase" amino acids 2 to 271 (270 residues), 398.1 bits, see alignment E=1.3e-123 PF00551: Formyl_trans_N" amino acids 76 to 253 (178 residues), 174.8 bits, see alignment E=7.6e-56

Best Hits

Swiss-Prot: 69% identical to PURU_ECOL6: Formyltetrahydrofolate deformylase (purU) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K01433, formyltetrahydrofolate deformylase [EC: 3.5.1.10] (inferred from 100% identity to son:SO_1624)

MetaCyc: 69% identical to formyltetrahydrofolate deformylase (Escherichia coli K-12 substr. MG1655)
Formyltetrahydrofolate deformylase. [EC: 3.5.1.10]

Predicted SEED Role

"Formyltetrahydrofolate deformylase (EC 3.5.1.10)" in subsystem One-carbon metabolism by tetrahydropterines (EC 3.5.1.10)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.1.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EGI0 at UniProt or InterPro

Protein Sequence (271 amino acids)

>SO1624 formyltetrahydrofolate deformylase (NCBI ptt file) (Shewanella oneidensis MR-1)
MTDCADAQGLIAKITGVCFNHQLNIIKNSEFVDNAQGRFFMRTELEGHFHCEQLLQDLRQ
VLPAQNHMTLVSAGKKRIVILVTKEAHCLGDLLMKAYYGGLNVEIAAVVGNHDVLRELVE
KFDIPFHLVSHEGLDRIQHEQALLAAVSQYSPDYLVLAKYMRVLTPDFVAEYPNRILNIH
HSFLPAFIGAAPYRQAWERGVKIIGATAHFVNNCLDEGPIIKQDVIPVDHSYSALEMAKA
GRDVEKSVLSKALQLVLNEQVVVYGNKTIVF