Protein Info for SO1580 in Shewanella oneidensis MR-1

Annotation: TonB-dependent heme receptor (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 737 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details TIGR01785: TonB-dependent heme/hemoglobin receptor family protein" amino acids 44 to 737 (694 residues), 326.2 bits, see alignment E=2.3e-101 PF07715: Plug" amino acids 64 to 160 (97 residues), 63.7 bits, see alignment E=2.1e-21 PF00593: TonB_dep_Rec_b-barrel" amino acids 265 to 709 (445 residues), 101.7 bits, see alignment E=9.4e-33

Best Hits

KEGG orthology group: K02014, iron complex outermembrane recepter protein (inferred from 100% identity to son:SO_1580)

Predicted SEED Role

"TonB-dependent heme receptor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EGM0 at UniProt or InterPro

Protein Sequence (737 amino acids)

>SO1580 TonB-dependent heme receptor (NCBI ptt file) (Shewanella oneidensis MR-1)
MGYQPKIGISKTMIGCLGLCALPALPLNAKEVLGAPKVEPIEILTVHGQQYRRATTMTKP
GEAIISMAEIEEMQATTFAEVIDDMAGAHIDGGTRSGGERINVWGFGETEDFNVYVDNAP
VGFEQYRYGSFFLDPDLIKRVEVIKGAHDVRSGNGGFGGAMYVVTKSADDFLKYDQSVGA
RVKASYASNNDAQSYTGTVYGRANQQLSGLLHFTRRDAQDVTLANGEAFEYSGYEQNNYL
GKVDYEQGDHQLMLSVTHYLDEGRKPWANRRGPMPAISDFNIRKYGSYEQALYATTAYNT
YEDNTWSANYRYSPSNPLIDTQIVVSHSANARHWIRPPIAWEKMTVSVGNFGHESWLDYK
RDYIDINNLSVVGAHEITAGLQFRSLDRTSLVFNKSYEKNPEKNFGWYTPYYQPEGRQDT
YAAYLRDAISLTDDLTITPSLRYDFVYSVGKPNIAPDYNDIAAGHDYSSTHHSGFSPRLG
VDYQLTPNTRVNFDYAYSLQAPVVDEIYAVQYAKASITATSRDIEVERLHAFKLGLINQQ
TDLFADQDALSTQITVYANLGRDDIAQRRGAKSDPNQAIQSGYTNLDGYEIYGADLESQY
RYQDFFSDLAVSWLQGEHRGSLKDSLGEDEYLANIAPLDIQLRVGMYITDSISVAWQGTW
YDAQDNVPEGDIFNAESPSENYFLQNIYLAYEPLDSLKGLSIRLMAKNLTNQQVTPFLSD
GIPAPGRDVRLSLAYEF