Protein Info for SO1575 in Shewanella oneidensis MR-1

Annotation: NOL1/NOP2/sun family putative RNA methylase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 486 PF01189: Methyltr_RsmB-F" amino acids 285 to 482 (198 residues), 133.1 bits, see alignment E=5.2e-43

Best Hits

KEGG orthology group: K03500, ribosomal RNA small subunit methyltransferase B [EC: 2.1.1.-] (inferred from 100% identity to son:SO_1575)

Predicted SEED Role

"Fmu (Sun) /eukaryotic nucleolar NOL1/Nop2p"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EGM5 at UniProt or InterPro

Protein Sequence (486 amino acids)

>SO1575 NOL1/NOP2/sun family putative RNA methylase (NCBI ptt file) (Shewanella oneidensis MR-1)
MLGHVPPLGSSSRLRVTQQGQATFQANFMGNPNGLSSTTIHSAFNIEPQTPAQKRAMSYA
NTTKLLFDEILSAKQPADRVLANYFREHKKHGSKDRKVIRESLFSLFRWWGWFKAAGDHQ
QAAHFFAMLSASALLEAHPWQDIAQAWHELSQSTHDYQRLQSIPVNNLTDKLALVRQLFP
QVVLELTDLLPEWFWQVCPIDAKRRPNLIEAMSSRPPIWGRAQSINSQTAVSQLQALGIE
ASLSPFFEDAINLGSKSMNLNEITLYKEGNIEIQDLASQVIGQICAPEPWQHWWDACSGA
GGKTLQLRSLMQTAATKQHTPLQGSIVSSDIRANALEELSKRAQRAQFDGISIARWRSDA
LPVAANYFDGVLVDAPCSCTGTWRRNPDMRWLDTLDAVMDKATLQLDILSRSSQAVKAGG
TLIYATCSLSPVENEEVVSAFLQQHPEFNLVPIRHPFTGEQTEMLTVWPFEANTDGMFVA
RMQRKH