Protein Info for SO1569 in Shewanella oneidensis MR-1

Annotation: integral membrane domain protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 283 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 33 to 52 (20 residues), see Phobius details amino acids 65 to 86 (22 residues), see Phobius details amino acids 92 to 110 (19 residues), see Phobius details amino acids 116 to 134 (19 residues), see Phobius details amino acids 140 to 159 (20 residues), see Phobius details amino acids 171 to 189 (19 residues), see Phobius details amino acids 195 to 217 (23 residues), see Phobius details amino acids 229 to 246 (18 residues), see Phobius details amino acids 252 to 273 (22 residues), see Phobius details PF00892: EamA" amino acids 4 to 133 (130 residues), 49.6 bits, see alignment E=2.3e-17 amino acids 142 to 268 (127 residues), 55.5 bits, see alignment E=3.6e-19

Best Hits

KEGG orthology group: None (inferred from 100% identity to son:SO_1569)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EGN1 at UniProt or InterPro

Protein Sequence (283 amino acids)

>SO1569 integral membrane domain protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MAPLLMILAAQLLIASGNLLVKLLETNTPVFQLVLYRQLFATLLVLPFVWHLQGNLKLSP
FYKVHLSRALLIGLGNAIFMLAVLHLPLATVTAVIYSSPLILLLLSAFFLNERIGYRRSV
AGLIGFTGILLISQPTEVNLYIGLAFFGAMISAINSLILKAYSTHEHPFSTLFWSNAFAM
VFLIPATWYEGANFSLPVAQVGLTLGVFYVGMTYLIIHAYRRADASQMAPVEYTGLIFAA
LLGWWFLDETLSVVVCIGIGLVIFSSLLPSYGELKAKWKSRRR