Protein Info for SO1559 in Shewanella oneidensis MR-1

Name: phoR
Annotation: phosphate regulon sensor protein PhoR (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 432 transmembrane" amino acids 14 to 45 (32 residues), see Phobius details PF11808: PhoR" amino acids 8 to 90 (83 residues), 106.3 bits, see alignment E=1.8e-34 TIGR02966: phosphate regulon sensor kinase PhoR" amino acids 95 to 423 (329 residues), 466.2 bits, see alignment E=2.7e-144 PF00989: PAS" amino acids 99 to 184 (86 residues), 27.9 bits, see alignment E=4.2e-10 PF00512: HisKA" amino acids 205 to 270 (66 residues), 68.2 bits, see alignment E=1e-22 PF02518: HATPase_c" amino acids 315 to 425 (111 residues), 91.3 bits, see alignment E=1.2e-29

Best Hits

Swiss-Prot: 52% identical to PHOR_ECOLI: Phosphate regulon sensor protein PhoR (phoR) from Escherichia coli (strain K12)

KEGG orthology group: K07636, two-component system, OmpR family, phosphate regulon sensor histidine kinase PhoR [EC: 2.7.13.3] (inferred from 100% identity to son:SO_1559)

MetaCyc: 52% identical to sensor histidine kinase PhoR (Escherichia coli K-12 substr. MG1655)
Histidine kinase. [EC: 2.7.13.3]

Predicted SEED Role

"Phosphate regulon sensor protein PhoR (SphS) (EC 2.7.13.3)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism (EC 2.7.13.3)

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EGP0 at UniProt or InterPro

Protein Sequence (432 amino acids)

>SO1559 phosphate regulon sensor protein PhoR (NCBI ptt file) (Shewanella oneidensis MR-1)
MFDSYSGYRLFTRLAVFLLLCLLIGLLVGNPLWILIIGLLGLVIWHYRQLARLNFWLWRD
RKLTPPQGSGSWEGVFNGIYRLQGKNRRRVGQLAALLGRFRQGAEALPDAAVVLDSEHNI
LWCNKLAQLMLGFVWPQDNGQRIDNLIRHPDFSAYIKAGKYKEPLELTSPVSERRLLEIR
IMAYGDRQLLLIARDITRIRQLEGMRKEFVANVSHELKTPLTVLQGYLEMMQSMAEPDSM
NAKPLALMQQQTQRMQSMVEQLLVLSRIEDAADIDLENTVNMSQLMDVLKEEAKALAKDK
YELSFHCEPGLDSHGNELQLRSACSNLISNAIRYTEPGGKISVQWRSVATGGLFSVADTG
EGIAPQHISRLTERFYRVDSARSRQTGGSGLGLAIVKHALSHHHSELNISSELGKGSTFS
FVIPQHLIERKK