Protein Info for SO1549 in Shewanella oneidensis MR-1

Name: xni
Annotation: exodeoxyribonuclease IX (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 236 PF02739: 5_3_exonuc_N" amino acids 11 to 134 (124 residues), 99.3 bits, see alignment E=2e-32 PF01367: 5_3_exonuc" amino acids 138 to 230 (93 residues), 89.9 bits, see alignment E=1.2e-29

Best Hits

Swiss-Prot: 100% identical to XNI_SHEON: Flap endonuclease Xni (xni) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K01146, protein Xni (inferred from 100% identity to son:SO_1549)

Predicted SEED Role

"DNA polymerase I (EC 2.7.7.7)" in subsystem DNA-replication or DNA Repair Base Excision (EC 2.7.7.7)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.7

Use Curated BLAST to search for 2.7.7.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EGP9 at UniProt or InterPro

Protein Sequence (236 amino acids)

>SO1549 exodeoxyribonuclease IX (NCBI ptt file) (Shewanella oneidensis MR-1)
MESLTERVSVACTKLLRIHHPTHVAVVWDGDEISWRKQLYPDYKKGRKPMPEPLAAGLIA
LQEHLQNLQIQSIYAAAEADDVIATLATKTAKAQGEALIVSTDKGFSQLNHPRISQWDHF
NQQYLNIAELEQKLGVDRSQFLDLMALAGDSGNKIPGIPGIGPKSAAELLRTFRTLATLF
SSLPNLGAKQAKKLAEGRDMARLSYKLVQLQTDLPLNINLRDFRVNSPTKASSNNL