Protein Info for SO1529 in Shewanella oneidensis MR-1

Name: pomA
Annotation: chemotaxis motA protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 255 transmembrane" amino acids 7 to 26 (20 residues), see Phobius details amino acids 32 to 50 (19 residues), see Phobius details amino acids 145 to 167 (23 residues), see Phobius details amino acids 179 to 201 (23 residues), see Phobius details PF01618: MotA_ExbB" amino acids 98 to 214 (117 residues), 96.7 bits, see alignment E=4.5e-32

Best Hits

Swiss-Prot: 69% identical to POMA_VIBAL: Chemotaxis protein PomA (pomA) from Vibrio alginolyticus

KEGG orthology group: K02556, chemotaxis protein MotA (inferred from 100% identity to son:SO_1529)

Predicted SEED Role

"Flagellar motor rotation protein MotA" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EGR6 at UniProt or InterPro

Protein Sequence (255 amino acids)

>SO1529 chemotaxis motA protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MDLATIIGLVGSFGFIIWSMVISGGVMMFYDLASVVIVFGGSFFVVMMKFNLKQFLGAVK
IAAKAFIFKIDRPEDLIEQSVTMADAARKGGFLALEEAQISNSFMQKAVDMLVDGHDGEV
VRAALEKDITLTEDRHRIGIAIFRAFADVGPAMGMIGTLVGLVAMLANMSDPKSIGPSMA
VALLTTLYGAVLANMVCIPIADKLSLRMGEEMLNRNLIMDAVLAIQDGQNPRVIEGFLKN
YLAEKQRKIDTTDGE