Protein Info for SO1501 in Shewanella oneidensis MR-1

Annotation: ATP-dependent RNA helicase, DEAD box family (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 456 PF00270: DEAD" amino acids 25 to 193 (169 residues), 155.7 bits, see alignment E=1.5e-49 PF04851: ResIII" amino acids 39 to 186 (148 residues), 27.1 bits, see alignment E=5.6e-10 PF00271: Helicase_C" amino acids 228 to 336 (109 residues), 103.6 bits, see alignment E=1.1e-33

Best Hits

Swiss-Prot: 51% identical to RHLE_ECOLI: ATP-dependent RNA helicase RhlE (rhlE) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to son:SO_1501)

MetaCyc: 51% identical to ATP-dependent RNA helicase RhlE (Escherichia coli K-12 substr. MG1655)
5.6.2.e [EC: 5.6.2.e]

Predicted SEED Role

"ATP-dependent RNA helicase SO1501" in subsystem ATP-dependent RNA helicases, bacterial

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.6.2.e

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EGU0 at UniProt or InterPro

Protein Sequence (456 amino acids)

>SO1501 ATP-dependent RNA helicase, DEAD box family (NCBI ptt file) (Shewanella oneidensis MR-1)
MKFDTLGLSSPLLNAITECGYQQLTQVQQQVIPLALVGKDIMACAQTGTGKTAAFALPVL
EQLAAKPADKPLLRALVMTPTRELAIQVCANIQKYSQFLPLKTLAVYGGANMNPQRKGVE
QGVDILVATPGRLFDIIGQFNLDLSSVTTLVIDEADRMLDLGFVRDIEKVKRLIAPVHQT
MLFSATYSDAVKQLSHKMLNQPQWVNVAENTTASTVEQLVYRVDKRRKAELLSELVGRNN
WRQVLVFASTKECAEHLLQELTLDGISAGVFHGDKTQGARNRVLDDFKAGKLRVLVATDV
AARGLDIQALPLVINLELPFLAEDYVHRIGRTGRAGLSGRAISFVSPADDEMLAEIEALI
GEKLPVTVQPGYEEGTPLPARYRDLPVVTTKTKWSYKAPKDRTIGKSSAGGKSSESQARA
RKSPSREGKYSKDKAKVSPSQPQRSGGKPHSGHKLK