Protein Info for SO1500 in Shewanella oneidensis MR-1

Annotation: sensory box protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 900 950 998 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details transmembrane" amino acids 28 to 50 (23 residues), see Phobius details amino acids 62 to 86 (25 residues), see Phobius details amino acids 93 to 112 (20 residues), see Phobius details amino acids 124 to 146 (23 residues), see Phobius details amino acids 155 to 174 (20 residues), see Phobius details PF07694: 5TM-5TMR_LYT" amino acids 22 to 179 (158 residues), 92.6 bits, see alignment E=8.7e-30 TIGR00229: PAS domain S-box protein" amino acids 196 to 313 (118 residues), 48.9 bits, see alignment E=6.8e-17 amino acids 318 to 446 (129 residues), 28.5 bits, see alignment E=1.4e-10 amino acids 444 to 566 (123 residues), 59.6 bits, see alignment E=3.3e-20 PF13426: PAS_9" amino acids 207 to 307 (101 residues), 26.6 bits, see alignment E=2.5e-09 amino acids 458 to 560 (103 residues), 49.1 bits, see alignment E=2.5e-16 PF08447: PAS_3" amino acids 218 to 287 (70 residues), 41.2 bits, see alignment 6.8e-14 amino acids 345 to 432 (88 residues), 49.2 bits, see alignment E=2.1e-16 amino acids 469 to 551 (83 residues), 36.3 bits, see alignment E=2.2e-12 PF13188: PAS_8" amino acids 452 to 493 (42 residues), 25.7 bits, see alignment (E = 3.3e-09) PF00989: PAS" amino acids 452 to 558 (107 residues), 44.5 bits, see alignment E=5.7e-15 PF08448: PAS_4" amino acids 454 to 562 (109 residues), 30.3 bits, see alignment E=1.7e-10 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 570 to 732 (163 residues), 160.1 bits, see alignment E=3.9e-51 PF00990: GGDEF" amino acids 572 to 729 (158 residues), 180.3 bits, see alignment E=9.6e-57 PF00563: EAL" amino acids 750 to 985 (236 residues), 257.2 bits, see alignment E=5.4e-80

Best Hits

KEGG orthology group: None (inferred from 100% identity to son:SO_1500)

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EGU1 at UniProt or InterPro

Protein Sequence (998 amino acids)

>SO1500 sensory box protein (NCBI ptt file) (Shewanella oneidensis MR-1)
MQNAALLLALVFLYDAIPKKHQRQYFLLWRLGIGVLIGGIGVAIMSTPWMYEPGIIFDTR
SVLLCVSGLFFGGLPTAIAVVITALYRLSIGGVAMWVGVGVIITSGLIGVIWRHYRKAHL
ASISGTEVISFAFLVHLVMLSWFFLLPGQHVVPVLSKITLPILLIYPLATWLLSRLLSRR
FELERDEQIRLQDDFLFRSQFNIGNIGIAITGIDQKWIKVNPRLCQMLKYSEDELLHMTW
KQLTHPDDLDADVAKFEQMLAGNIDNYELDKRFIAKNGSLVYTHMTVACKRTNHQVLLVI
SGYLDVTAQTLADREVLASREQLELVLSSSDLGVWDWDIRNDHIERNTRSADILGCDIDM
LNANSRQWMDSIVAEDRPQVLQSIEAHIRGETPQHKMEYRLKTLNRDIRWILDTGKVVSR
DANNNALRMCGTYTDITEAKLIEESLKLSALVYDNSSEAMSVLDENGVIITVNAAFTDIT
GYSESEIRGQHIRMMYCDLNGHEFYQQMNDDIRNKGEWQGEMRQRRRNNEEYVIWLTINT
IKDKDGLPHRRVALFSDITDKKQSEHLIWKQANYDTLTGLPNRRMLLEYLSAEIKTADRN
RNHFALMFLDLDYFKEVNDTLGHAMGDLLLIETASRLKSCVRDADVVARLGGDEFTVVLS
SMADHKGIERVAEHILRRIAEPYYLGEETTHISASIGITLYPDDSPSIEGLLKHADQAMY
AAKDQGRNRFNYFTPSMQEYAKYRMRLIHDLRQAVLNKEFELHYQPIVTMATGEVLKAEA
LLRWFHPERGSVSPAEFIPVAEDTGLIVEIGNWVFEQAARQSAQWRKTLGVEIQISVNKS
PIQFRDEGALLHNWLELLQQLDVTGAGVCVEITEGLLLDASMGVTEKLLAYRDAGVQVSL
DDFGTGYSSLAYLKKFDIDYLKIDQSFTRNIDTDENDHTLCEAIIVMAHKLGMKVIAEGV
ETEAQRQVLLRAGCDYGQGYLFSKPVSASEFASKYLLT