Protein Info for SO1430 in Shewanella oneidensis MR-1

Name: dmsB-1
Annotation: anaerobic dimethyl sulfoxide reductase, B subunit (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 224 TIGR02951: dimethylsulfoxide reductase, chain B" amino acids 6 to 182 (177 residues), 227.3 bits, see alignment E=5.2e-72 PF12800: Fer4_4" amino acids 14 to 27 (14 residues), 14.5 bits, see alignment (E = 1.5e-05) amino acids 115 to 131 (17 residues), 19.1 bits, see alignment (E = 5e-07) PF13247: Fer4_11" amino acids 77 to 172 (96 residues), 89.2 bits, see alignment E=7.1e-29 PF13187: Fer4_9" amino acids 85 to 131 (47 residues), 28.2 bits, see alignment 6.3e-10 PF12838: Fer4_7" amino acids 85 to 132 (48 residues), 30.1 bits, see alignment 2.2e-10 PF12837: Fer4_6" amino acids 111 to 133 (23 residues), 25.4 bits, see alignment (E = 4e-09) PF00037: Fer4" amino acids 112 to 133 (22 residues), 28.7 bits, see alignment (E = 3.3e-10)

Best Hits

KEGG orthology group: K07307, anaerobic dimethyl sulfoxide reductase subunit B (DMSO reductase iron- sulfur subunit) (inferred from 100% identity to son:SO_1430)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EH02 at UniProt or InterPro

Protein Sequence (224 amino acids)

>SO1430 anaerobic dimethyl sulfoxide reductase, B subunit (NCBI ptt file) (Shewanella oneidensis MR-1)
MTQQTQYGFYFDSSKCTGCKTCHIACKDRMTGLVRAKDDVMNNGVANLPGIIWRRVYEYG
GGNWSQNVDGSFEQNVFAYYMSIGCNHCSQPVCVKACPTGAMHKRREDGLVQVATELCIG
CESCARACPYDAPQLDIERKVMTKCDGCSDRLAEGKKPICVDSCPLRALDFDTMDNLRAK
YGEGDGHIAPLPSPSITSPNLIIKANRNGQPVGGSGQLLNPAEV