Protein Info for SO1417 in Shewanella oneidensis MR-1

Annotation: sensor histidine kinase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 601 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details transmembrane" amino acids 312 to 330 (19 residues), see Phobius details PF12974: Phosphonate-bd" amino acids 35 to 273 (239 residues), 98.3 bits, see alignment E=9.8e-32 PF00512: HisKA" amino acids 375 to 434 (60 residues), 36.2 bits, see alignment 1e-12 PF02518: HATPase_c" amino acids 480 to 584 (105 residues), 64.5 bits, see alignment E=2.4e-21 PF14501: HATPase_c_5" amino acids 486 to 583 (98 residues), 22.8 bits, see alignment E=1.4e-08

Best Hits

KEGG orthology group: None (inferred from 100% identity to son:SO_1417)

Predicted SEED Role

"Tetrathionate reductase sensory transduction histidine kinase" in subsystem Tetrathionate respiration

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EH14 at UniProt or InterPro

Protein Sequence (601 amino acids)

>SO1417 sensor histidine kinase (NCBI ptt file) (Shewanella oneidensis MR-1)
MSQFFTRLMFILALFIDFNLPVIAADSHANDPVRIGIMAFNEPDEVMANWQPTADWLSQQ
LHRPVQLMPLTPSQLDEALVKQSIDFLIGNALTTVAFKRNYGTSHLLTLVHNRVRSPEQS
IGSAIVARIDSNLSQWDQLKDEKLVSSDPQAFGGFQIFAATMATKGINAYRDIPKLRFIG
FPQQKLLQMVLSGEADIAVLPSCVLENALDKGLVPANKLKVVLKQPHPDFACEVSTQLYP
GYALTKLGHTDHKLATQVVASLLQITPDTPAAQQGRYQYWSAPVDDSPVFELLKQLEQWP
FVTNWQRLLHNALPWGTSLIFVLLLGYIHHLRVKRLVVKRTQALSDEITHHQHTQKILLE
QQQQFYRAQRVLLTGEMASGIAHELKQPLAGIRYLTQGCLYRLDNTQAELATALNKVISQ
VDRAQTTIHRLRTFCQQTSDYQSCDLRTVIEETLTLMQPEFQRLKLSPKVNLQALPVFAD
ASLMQQVLVNLLRNALDAMESIPQKSLFIDTGITGENVYIHITDAGCGLSDSALKRLFFP
FETSKPQGLGLGMVICKRIIEEHKGKIEAHHANPGLTIKVTLPVNSQPGLGEQNDTALPR
G