Protein Info for SO1414 in Shewanella oneidensis MR-1

Annotation: flavocytochrome c flavin subunit, putative (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 506 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details PF00890: FAD_binding_2" amino acids 43 to 484 (442 residues), 205.6 bits, see alignment E=3.1e-64 TIGR01813: flavocytochrome c" amino acids 43 to 498 (456 residues), 576 bits, see alignment E=2.5e-177 PF12831: FAD_oxidored" amino acids 43 to 211 (169 residues), 32 bits, see alignment E=1.7e-11 PF01266: DAO" amino acids 43 to 255 (213 residues), 43.8 bits, see alignment E=5.2e-15 PF13450: NAD_binding_8" amino acids 46 to 82 (37 residues), 25.1 bits, see alignment 3.5e-09

Best Hits

KEGG orthology group: None (inferred from 100% identity to son:SO_1414)

Predicted SEED Role

"Flavocytochrome c flavin subunit" in subsystem Flavocytochrome C

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EH17 at UniProt or InterPro

Protein Sequence (506 amino acids)

>SO1414 flavocytochrome c flavin subunit, putative (NCBI ptt file) (Shewanella oneidensis MR-1)
MHDRRSFLKLGAGAAVGGIAAALPSAASATECASNIKWDETRDIIVVGSGFAGLSSALNA
KRQGLGSILVLEKMQVIGGNSAINGGWLAIPKNPIQLAQGIQDDSPEELVKDQIISGRGM
QNTDMLRQMANRALDAYQLCIDAGVKFREGFNQQVGGHNKARAIRTQHGVGGDITTKLYE
VGKKEGVEYRLQHYVEDFIMDGQQIVGLKVRQNYRFPDLKTGKTIYIKANKAVILAHGGF
SRNLVLRELVDPALDKTLDCTNALGATGEVTLTAMAHGAFPVHMSFIQTGHWGSPDEGGF
GWSNALLSIGFHKGISVNVLDGKRFMNERADRKTCSDAIMKNRNPDGSPAYPVVFFNHDD
HVGAEEVTRAVRDQIAWKVDSLEQLAKQFNIPLAQLKQTVAEYNKQVPQRIDPLFGRMMD
TAVELKAPFIVSRIWPKVHYCMGGLKTDLGARVLHSQTLAPMKNLYAVGEATGGTHGGTR
LSSTACLECLTMGIIVAETIKSDMQA