Protein Info for SO1406 in Shewanella oneidensis MR-1

Annotation: mercuric transport protein MerT, putative (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 120 transmembrane" amino acids 12 to 39 (28 residues), see Phobius details amino acids 52 to 72 (21 residues), see Phobius details amino acids 92 to 115 (24 residues), see Phobius details

Best Hits

KEGG orthology group: K08363, mercuric ion transport protein (inferred from 100% identity to son:SO_1406)

Predicted SEED Role

"mercuric transport protein MerT, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8EH25 at UniProt or InterPro

Protein Sequence (120 amino acids)

>SO1406 mercuric transport protein MerT, putative (NCBI ptt file) (Shewanella oneidensis MR-1)
MTTSQASSVKQLFATMAAAVIAAVASSLCCIAPLIYLVFGVSAAGLSGLSSLGWLQVPML
ILSTGLILLGFWRLYFAKKPLCTGKFSRGQMLLIYWLSVPIVLAFQLYPFVLPWLLEVFE